Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311605

ADAM Metallopeptidase Domain 7 (ADAM7) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ADAM 7, ADAM-7, EAPI, GP-83, GP83, 7, ADAM, EAP, EAP I, I, 9230104J12Rik, EAP1, ADAM7
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311605
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ADAM7 antibody: synthetic peptide directed towards the C terminal of human ADAM7
Sequence PTETLGVENKGYFGDEQQIRTEPILPEIHFLNKPASKDSR GIADPNQSAK
Predicted Reactivity Human : 100%, Mouse : 90%, Dog : 85%, Horse : 84%
Characteristics This is a rabbit polyclonal antibody against ADAM7. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ADAM7
Background The ADAM family is composed of zinc-binding proteins that can function as adhesion proteins and/or endopeptidases. They are involved in a number of biologic processes, including fertilization, neurogenesis, muscle development, and immune response.The ADAM family is composed of zinc-binding proteins that can function as adhesion proteins and/or endopeptidases. They are involved in a number of biologic processes, including fertilization, neurogenesis, muscle development, and immune response.
Molecular Weight 83kDa
Gene ID 8756
NCBI Accession NP_003808, NM_003817
UniProt Q9H2U9
Research Area Proteolysis / Ubiquitin, Metalloprotease, Extracellular Matrix
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ADAM7 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Seals, Courtneidge: "The ADAMs family of metalloproteases: multidomain proteins with multiple functions." in: Genes & development, Vol. 17, Issue 1, pp. 7-30, 2003 (PubMed).

Alternatives for antigen "ADAM Metallopeptidase Domain 7 (ADAM7)", type "Antibodies"
Hosts (3), (1)
Reactivities (3), (1), (1)
Applications (4), (1), (1)
Epitopes (2), (1)
Beacon