ADAM Metallopeptidase Domain 7 (ADAM7) (C-Term) antibody

Details for Product No. ABIN311605
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms ADAM 7, ADAM-7, EAPI, GP-83, GP83, 7, ADAM, EAP, EAP I, I, 9230104J12Rik, EAP1, ADAM7
Epitope
C-Term
(2)
Reactivity
Mouse (Murine), Dog (Canine), Human
(2), (1), (1)
Host
Rabbit
(3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(3)
Pubmed 1 reference available
Catalog no. ABIN311605
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human ADAM7
Sequence PTETLGVENKGYFGDEQQIRTEPILPEIHFLNKPASKDSR GIADPNQSAK
Predicted Reactivity Human : 100 %, Mouse : 90 %, Dog : 80 %, Horse : 80 %
Characteristics This is a rabbit polyclonal antibody against ADAM7. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ADAM7
Background The ADAM family is composed of zinc-binding proteins that can function as adhesion proteins and/or endopeptidases. They are involved in a number of biologic processes, including fertilization, neurogenesis, muscle development, and immune response.The ADAM family is composed of zinc-binding proteins that can function as adhesion proteins and/or endopeptidases. They are involved in a number of biologic processes, including fertilization, neurogenesis, muscle development, and immune response.
Molecular Weight 83 kDa
Gene ID 8756
NCBI Accession NM_003817, NP_003808
UniProt Q9H2U9
Research Area Proteolysis / Ubiquitin, Metalloprotease, Extracellular Matrix
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 754 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-ADAM Metallopeptidase Domain 7 (ADAM7) (C-Term) antibody WB Suggested Anti-ADAM7 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate
Background publications Seals, Courtneidge: "The ADAMs family of metalloproteases: multidomain proteins with multiple functions." in: Genes & development, Vol. 17, Issue 1, pp. 7-30, 2003 (PubMed).

Hosts (3)
Reactivities (2), (1), (1)
Applications (3)
Epitopes (2)
back to top