Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311668

ATG5 Autophagy Related 5 Homolog (S. Cerevisiae) (ATG5) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
ASP, APG5, APG5L, hAPG5, APG5-LIKE, Apg5l, Atg5l, Paddy, C88337, AW319544, 2010107M05Rik, 3110067M24Rik, apg5l, zgc:100934, ATATG5, ATG5, AUTOPHAGY 5, MKP11.20, MKP11_20, CG1643, DmAtg5, Dmel\\CG1643, ... show more
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN311668
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ATG5 antibody: synthetic peptide directed towards the C terminal of human ATG5
Sequence DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHI SIIPQPTD
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Chicken : 92%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against ATG5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ATG5
Background ATG5 is required for autophagy. It conjugates to ATG12 and associates with isolation membrane to form cup-shaped isolation membrane and autophagosome. The conjugate detaches from the membrane immediately before or after autophagosome formation is completed. ATG5 may play an important role in the apoptotic process, possibly within the modified cytoskeleton. Its expression is a relatively late event in the apoptotic process, occurring downstream of caspase activity.
Molecular Weight 32kDa
Gene ID 9474
NCBI Accession NP_004840, NM_004849
UniProt Q9H1Y0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ATG5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "ATG5 Autophagy Related 5 Homolog (S. Cerevisiae) (ATG5)", type "Antibodies"
Hosts (96), (24), (14), (4), (3)
Reactivities (127), (71), (59), (36), (33), (18), (16), (16), (13), (13), (2), (1), (1), (1), (1)
Applications (124), (56), (53), (25), (20), (10), (10), (6), (3), (2), (1), (1)
Conjugates (4), (4), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (32), (10), (10), (10), (4), (4), (2), (1), (1), (1), (1), (1), (1)
Beacon