DcR1 antibody (AA 33-63)

Catalog No. ABIN342737

Product Details anti-DcR1 Antibody

Target: DcR1 (TNFRSF10C) (Tumor Necrosis Factor Receptor Superfamily, Member 10c (TNFRSF10C))

Binding Specificity: AA 33-63

Reactivity: Human

Host: Goat

Clonality: Polyclonal

Conjugate: This DcR1 antibody is un-conjugated

Application: Western Blotting (WB), ELISA, Flow Cytometry (FACS), Immunohistochemistry (IHC), Immunocytochemistry (ICC)

Specificity: This antibody recognizes human TRAIL-3 receptor and may cross-react with mouse TRAIL-R3 as Western blotting shows a similar size protein of ~33 kD from mouse spleen. TRAIL-R2 peptide from the same region does not bind to this antibody. For TRAIL-R1 there is low sequence homology in this region. This antibody may bind to TRAIL-R4.

Predicted Reactivity: Percent identity by BLAST analysis: Human, Gorilla (100%) Orangutan (87%) Marmoset (84%).

Purification: Immunoaffinity purified

Immunogen: Synthetic peptide EVPQQTVAPQQQRHSFKGEECPAGSHRSEHTC aa 33-63, corresponding to the extracellular domain sequence of human TRAIL-R3 (DcR1). Percent identity by BLAST analysis: Human, Gorilla (100%), Orangutan (87%), Marmoset (84%).

Type of Immunogen: Synthetic peptide

Application Details

Application Notes: Approved: ELISA (1:150000), Flo, ICC, IHC, WB

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: Lot specific

Buffer: Phosphate buffered saline, 0.1 % sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Aliquot to Avoid freeze/thaw cycles.

Storage: -20 °C

Storage Comment: Store at -20°C. Aliquot to avoid freeze/thaw cycles.

Target Details for DcR1

Target: DcR1 (TNFRSF10C) (Tumor Necrosis Factor Receptor Superfamily, Member 10c (TNFRSF10C))

Alternative Name: TNFRSF10C / TRAIL-R3 / DCR1 (TNFRSF10C Products)

Synonyms: CD263 antibody, DCR1 antibody, DCR1-TNFR antibody, LIT antibody, TRAIL-R3 antibody, TRAILR3 antibody, TRID antibody, TNFRSF10C antibody, TNF receptor superfamily member 10c antibody, TNFRSF10C antibody

Background: Name/Gene ID: TNFRSF10C
Family: TNF Receptor

Synonyms: TNFRSF10C, CD263 antigen, CD263, Cytotoxic TRAIL receptor-3, Decoy receptor 1, DCR1, DCR1-TNFR, LIT, Lymphocyte inhibitor of TRAIL, TRAIL-R3, TRAILR3, TRAIL receptor 3, TRID

Gene ID: 8794

UniProt: O14798

Pathways: Apoptosis