TLR5 antibody (AA 151-181)
-
- Target See all TLR5 Antibodies
- TLR5 (Toll-Like Receptor 5 (TLR5))
-
Binding Specificity
- AA 151-181
-
Reactivity
- Human
-
Host
- Goat
-
Clonality
- Polyclonal
-
Conjugate
- This TLR5 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), ELISA, Immunocytochemistry (ICC), Flow Cytometry (FACS)
- Specificity
- Peptide sequence is <50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR5 and was not tested for cross-reactivity to mouse TLR5.
- Predicted Reactivity
- Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Macaque, Monkey, Spider monkey, Siamang (100%) Colobus monkey, Baboon (97%) Marmoset (94%) Sheep, Goat, Panda, Water buffalo (84%) Zebu, Bovine (81%).
- Purification
- Immunoaffinity purified
- Immunogen
-
Synthetic peptide DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ corresponding to aa 151-181 of human TLR5. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Macaque, Monkey, Spider monkey, Siamang (100%), Colobus monkey, Baboon (97%), Marmoset (94%), Sheep, Goat, Panda, Water buffalo (84%), Zebu, Bovine (81%).
Type of Immunogen: Synthetic peptide - Top Product
- Discover our top product TLR5 Primary Antibody
-
-
- Application Notes
- Approved: ELISA (1:35000), Flo (1:50), ICC (1:250), IHC (1:125), WB (1:100)
- Comment
-
Target Species of Antibody: Human
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- Lot specific
- Buffer
- Phosphate buffered saline, 1 mg/mL BSA, 0.1 % sodium azide
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid freeze-thaw cycles.
- Storage
- -20 °C,-80 °C
- Storage Comment
-
Short term: -20°C
Long term: -70°C
Avoid freeze-thaw cycles.
-
- Target
- TLR5 (Toll-Like Receptor 5 (TLR5))
- Alternative Name
- TLR5 (TLR5 Products)
- Synonyms
- SLEB1 antibody, TIL3 antibody, TLR-5 antibody, sleb1 antibody, til3 antibody, tlr-5 antibody, tlr5 antibody, toll like receptor 5 antibody, toll-like receptor 5 antibody, toll like receptor 5 L homeolog antibody, toll-like receptor 5b antibody, TLR5 antibody, Tlr5 antibody, tlr5.L antibody, tlr-5 antibody, tlr5b antibody
- Background
-
Name/Gene ID: TLR5
Family: Toll-like Receptor
Synonyms: TLR5, TIL3, Toll-like receptor 5, SLEB1 - Gene ID
- 7100
- UniProt
- O60602
- Pathways
- TLR Signaling, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Toll-Like Receptors Cascades
-