Did you know that you can buy products from over 140 different suppliers from us?

Homeobox B8 (HOXB8) (Middle Region) antibody

Details for Product No. ABIN405048
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HOX2, HOX2D, Hox-2.4, Hox2r1a
Epitope
Middle Region
(17), (10), (7), (3), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Dog (Canine), Human
(35), (20), (13), (13), (12), (1), (1)
Host
Rabbit
(36), (6)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(31), (23), (10), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405048
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human HOXB8
Sequence FQNRRMKWKKENNKDKFPSSKCEQEELEKQKLERAPEAAD EGDAQKGDKK
Predicted Reactivity Dog : 100 %, Human : 100 %, Pig : 100 %, Mouse : 70 %, Rat : 70 %
Characteristics This is a rabbit polyclonal antibody against HOXB8. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name HOXB8
Background HOXB8 belongs to the Antp homeobox family. It is a nuclear protein with a homeobox DNA-binding domain. This gene is included in a cluster of homeobox B genes located on chromosome 17. The protein functions as a sequence-specific transcription factor that is involved in development. Increased expression of this gene is associated with colorectal cancer. Mice that have had the murine ortholog of this gene knocked out exhibit an excessive pathologic grooming behavior. This behavior is similar to the behavior of humans suffering from the obsessive-compulsive spectrum disorder trichotillomania.This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development. Increased expression of this gene is associated with colorectal cancer. Mice that have had the murine ortholog of this gene knocked out exhibit an excessive pathologic grooming behavior. This behavior is similar to the behavior of humans suffering from the obsessive-compulsive spectrum disorder trichotillomania.
Molecular Weight 27 kDa
Gene ID 3218
NCBI Accession NM_024016, NP_076921
UniProt P17481
Research Area Embryogenesis, Embryonic stem cells, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 243 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Kosaki, Kosaki, Suzuki et al.: "Complete mutation analysis panel of the 39 human HOX genes." in: Teratology, Vol. 65, Issue 2, pp. 50-62, 2002 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405048
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top