Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405216

Zinc Finger Protein 280C (ZNF280C) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SUHW3, ZNF633, BC028839, Suhw3, Zfp633, Znf280c, mKIAA1584
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405216
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF280C antibody: synthetic peptide directed towards the N terminal of human ZNF280C
Sequence DDDKPFQPKNISKMAELFMECEEEELEPWQKKVEETQDED DDELIFVGEI
Predicted Reactivity Human : 100%, Horse : 78%, Pig : 78%
Characteristics This is a rabbit polyclonal antibody against ZNF280C. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF280C
Background ZNF280C contains 5 C2H2-type zinc fingers. It may function as a transcription factor.
Molecular Weight 83kDa
Gene ID 55609
NCBI Accession NP_060136, NM_017666
UniProt Q8ND82
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF280°Cantibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Alternatives for antigen "Zinc Finger Protein 280C (ZNF280C)", type "Antibodies"
Hosts (12), (1)
Reactivities (13)
Applications (13), (9), (1)
Epitopes (4), (1), (1)
Beacon