Zinc Finger Protein 280C (ZNF280C) (N-Term) antibody

Details for Product No. ABIN405216
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms SUHW3, ZNF633, BC028839, Suhw3, Zfp633, Znf280c, mKIAA1584
Epitope
N-Term
(5), (1), (1), (1)
Reactivity
Human
(15)
Host
Rabbit
(14), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(15), (10), (1)
Pubmed 1 reference available
Catalog no. ABIN405216
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF280C
Sequence DDDKPFQPKNISKMAELFMECEEEELEPWQKKVEETQDED DDELIFVGEI
Predicted Reactivity Human : 100 %, Horse : 70 %, Pig : 70 %
Characteristics This is a rabbit polyclonal antibody against ZNF280C. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF280C
Background ZNF280C contains 5 C2H2-type zinc fingers. It may function as a transcription factor.
Molecular Weight 83 kDa
Gene ID 55609
NCBI Accession NM_017666, NP_060136
UniProt Q8ND82
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 737 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 280C (ZNF280C) (N-Term) antibody WB Suggested Anti-ZNF280C Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome...." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Hosts (14), (1)
Reactivities (15)
Applications (15), (10), (1)
Epitopes (5), (1), (1), (1)
back to top