Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405408

Creatine Kinase, Muscle (CKM) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CKMM, M-CK, MCK, Ckmm, ckmm, m-ck, CKM
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Pig (Porcine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405408
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CKM antibody: synthetic peptide directed towards the N terminal of human CKM
Sequence VGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLN HENLKGGDDL
Predicted Reactivity African clawed frog : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against CKM. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CKM
Background CKM is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. CKM is a member of the ATP: guanido phosphotransferase protein family.The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family.
Molecular Weight 43kDa
Gene ID 1158
NCBI Accession NP_001815, NM_001824
UniProt P06732
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CKM antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Yamin, Amir, Sagiv et al.: "ACE ID genotype affects blood creatine kinase response to eccentric exercise." in: Journal of applied physiology (Bethesda, Md. : 1985), Vol. 103, Issue 6, pp. 2057-61, 2007 (PubMed).

Alternatives for antigen "Creatine Kinase, Muscle (CKM)", type "Antibodies"
Hosts (61), (35), (29)
Reactivities (110), (29), (23), (5), (3), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Applications (85), (73), (22), (12), (10), (8), (6), (4), (4), (3), (2), (2), (1)
Conjugates (8), (2), (1), (1), (1)
Epitopes (12), (5), (4), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon