Creatine Kinase, Muscle (CKM) (N-Term) antibody

Details for Product No. ABIN405408
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CKMM, M-CK, MCK, Ckmm, ckmm, m-ck, CKM
Epitope
N-Term
(13), (4), (4), (4), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Pig (Porcine), Zebrafish (Danio rerio), Human, Chicken
(122), (29), (24), (5), (4), (3), (3), (3), (1), (1), (1), (1)
Host
Rabbit
(76), (41), (32), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(9), (3), (2), (1), (1)
Application
Western Blotting (WB)
(97), (91), (29), (21), (21), (13), (8), (8), (8), (4), (4), (4), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN405408
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human CKM
Sequence VGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLN HENLKGGDDL
Predicted Reactivity African clawed frog : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against CKM. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CKM
Background CKM is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. CKM is a member of the ATP: guanido phosphotransferase protein family.The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family.
Molecular Weight 43 kDa
Gene ID 1158
NCBI Accession NM_001824, NP_001815
UniProt P06732
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 381 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Yamin, Amir, Sagiv et al.: "ACE ID genotype affects blood creatine kinase response to eccentric exercise." in: Journal of applied physiology (Bethesda, Md. : 1985), Vol. 103, Issue 6, pp. 2057-61, 2007 (PubMed).

Hosts (76), (41), (32), (1)
Reactivities (122), (29), (24), (5), (4), (3), (3), (3), (1), (1), (1), (1)
Applications (97), (91), (29), (21), (21), (13), (8), (8), (8), (4), (4), (4), (3), (2)
Conjugates (9), (3), (2), (1), (1)
Epitopes (13), (4), (4), (4), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top