Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405577

Alcohol Dehydrogenase 4 (Class II), pi Polypeptide (ADH4) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ADH-2, Adh2, ADH-1, Ac1002
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 2 references available
Catalog no. ABIN405577
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ADH4 antibody: synthetic peptide directed towards the middle region of human ADH4
Sequence PLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFF GTSTFSQYTV
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against ADH4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ADH4
Background ADH4, class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene encodes class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene is localized to chromosome 4 in the cluster of alcohol dehydrogenase genes.
Molecular Weight 40kDa
Gene ID 127
NCBI Accession NP_000661, NM_000670
UniProt P08319
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ADH4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Kuo, Yu, Petrovich et al.: "The CyberKnife stereotactic radiosurgery system: description, installation, and an initial evaluation of use and functionality." in: Neurosurgery, Vol. 62 Suppl 2, pp. 785-9, 2008 (PubMed).

Background publications Kuo, Kalsi, Prescott et al.: "Association of ADH and ALDH genes with alcohol dependence in the Irish Affected Sib Pair Study of alcohol dependence (IASPSAD) sample." in: Alcoholism, clinical and experimental research, Vol. 32, Issue 5, pp. 785-95, 2008 (PubMed).

Alternatives for antigen "Alcohol Dehydrogenase 4 (Class II), pi Polypeptide (ADH4)", type "Antibodies"
Hosts (15), (9)
Reactivities (22), (6), (3), (1)
Applications (22), (12), (6), (4), (4), (3), (2), (1), (1)
Epitopes (4), (4), (4), (2), (2), (2), (1)
Beacon