Solute Carrier Family 27 (Fatty Acid Transporter), Member 2 (SLC27A2) (N-Term) antibody

Details for Product No. ABIN405598
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ACSVL1, FATP2, VLCS, Vlac, Vlacs, FACVL1, HsT17226, VLACS, hFACVL1, vlcs, fatp2, vlacs, acsvl1, facvl1, im:7139614, slc27a2, wu:fb99g05, zgc:112376, fatp6, acsvl2, facvl2, vlcs-h1
Epitope
N-Term
(1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(22), (18), (18), (12), (12), (12)
Host
Rabbit
(20), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(13), (10), (8), (8), (3), (3)
Pubmed 1 reference available
Catalog no. ABIN405598
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SLC27A2
Sequence LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLM GNEPAYVWLW
Predicted Reactivity Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Bovine : 90 %, Dog : 90 %, Guinea pig : 90 %, Horse : 90 %, Rabbit : 90 %
Characteristics This is a rabbit polyclonal antibody against SLC27A2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SLC27A2
Background SLC27A2 is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme activates long-chain, branched-chain and very-long-chain fatty acids containing 22 or more carbons to their CoA derivatives. It is expressed primarily in liver and kidney, and is present in both endoplasmic reticulum and peroxisomes, but not in mitochondria. Its decreased peroxisomal enzyme activity is in part responsible for the biochemical pathology in X-linked adrenoleukodystrophy.The protein encoded by this gene is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme activates long-chain, branched-chain and very-long-chain fatty acids containing 22 or more carbons to their CoA derivatives. It is expressed primarily in liver and kidney, and is present in both endoplasmic reticulum and peroxisomes but not in mitochondria. Its decreased peroxisomal enzyme activity is in part responsible for the biochemical pathology in X-linked adrenoleukodystrophy.
Molecular Weight 70 kDa
Gene ID 11001
NCBI Accession NM_003645, NP_003636
UniProt O14975
Research Area Cancer, Fatty Acids, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 620 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Solute Carrier Family 27 (Fatty Acid Transporter), Member 2 (SLC27A2) (N-Term) antibody anti-Solute Carrier Family 27 (Fatty Acid Transporter), Member 2 (SLC27A2) (N-Term) antibody
anti-Solute Carrier Family 27 (Fatty Acid Transporter), Member 2 (SLC27A2) (N-Term) antibody (2) anti-Solute Carrier Family 27 (Fatty Acid Transporter), Member 2 (SLC27A2) (N-Term) antibody (Image 2)
anti-Solute Carrier Family 27 (Fatty Acid Transporter), Member 2 (SLC27A2) (N-Term) antibody (3) anti-Solute Carrier Family 27 (Fatty Acid Transporter), Member 2 (SLC27A2) (N-Term) antibody (Image 3)
Background publications Mihalik, Steinberg, Pei et al.: "Participation of two members of the very long-chain acyl-CoA synthetase family in bile acid synthesis and recycling." in: The Journal of biological chemistry, Vol. 277, Issue 27, pp. 24771-9, 2002 (PubMed).

Hosts (20), (3)
Reactivities (22), (18), (18), (12), (12), (12)
Applications (13), (10), (8), (8), (3), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top