Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405677

Chromosome 10 Open Reading Frame 38 (C10ORF38) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C10orf38
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405677
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C10orf38 antibody: synthetic peptide directed towards the middle region of human C10orf38
Sequence ARKSMEREGYESSGNDDYRGSYNTVLSQPLFEKQDREGPA STGSKLTIQE
Predicted Reactivity Sumatran orangutan :100%,   Human :100%,  
Characteristics This is a rabbit polyclonal antibody against C10orf38. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C10orf38
Background The exact function of C10orf38 remains unknown.
Molecular Weight 98kDa
Gene ID 221061
NCBI Accession NP_001010924, NM_001010924
UniProt Q5VUB5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C10orf38 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Alternatives for antigen "Chromosome 10 Open Reading Frame 38 (C10ORF38)", type "Antibodies"
Hosts (3)
Reactivities (2)
Applications (3), (1)
Epitopes (1), (1)
Beacon