Did you know that you can buy products from over 140 different suppliers from us?

delta-Like 1 (DLL1) (N-Term) antibody

Details for Product No. ABIN405837
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DL1, Delta, DELTA1, XDelta1, Xdelta-1, delta-1, delta1, x-delta, Delta1, X-delta-1, delta, DLL1
Epitope
N-Term
(5), (4), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Cow (Bovine), Human, Chicken
(46), (40), (21), (14), (12), (1)
Host
Rabbit
(37), (14), (10), (5), (4), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB), Immunohistochemistry (IHC)
(42), (40), (24), (14), (11), (10), (10), (5), (2), (1), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405837
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human DLL1
Sequence GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGN RNCCRGGAGP
Predicted Reactivity Bovine : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Chicken : 90 %, Rabbit : 90 %
Characteristics This is a rabbit polyclonal antibody against DLL1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name DLL1
Background DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication.DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication.
Molecular Weight 78 kDa
Gene ID 28514
NCBI Accession NM_005618, NP_005609
UniProt O00548
Research Area Embryogenesis, Embryonic stem cells, Hematopoietic Progenitors, Hematopoietic Stem Cells, Transcription Factors, Neurogenesis, Lineage Markers
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 723 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-delta-Like 1 (DLL1) (N-Term) antibody WB Suggested Anti-DLL1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate
anti-delta-Like 1 (DLL1) (N-Term) antibody (2) anti-delta-Like 1 (DLL1) (N-Term) antibody (Image 2)
anti-delta-Like 1 (DLL1) (N-Term) antibody (3) anti-delta-Like 1 (DLL1) (N-Term) antibody (Image 3)
Background publications Dezso, Halász, Bisgaard et al.: "Delta-like protein (DLK) is a novel immunohistochemical marker for human hepatoblastomas." in: Virchows Archiv : an international journal of pathology, Vol. 452, Issue 4, pp. 443-8, 2008 (PubMed).

Hosts (37), (14), (10), (5), (4), (4)
Reactivities (46), (40), (21), (14), (12), (1)
Applications (42), (40), (24), (14), (11), (10), (10), (5), (2), (1), (1), (1), (1)
Conjugates (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (4), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405837
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top