Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405837

delta-Like 1 (DLL1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DL1, Delta, DELTA1, XDelta1, Xdelta-1, delta-1, delta1, x-delta, Delta1, X-delta-1, delta, DLL1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN405837
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DLL1 antibody: synthetic peptide directed towards the N terminal of human DLL1
Sequence GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGN RNCCRGGAGP
Predicted Reactivity Bovine : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Chicken : 92%, Rabbit : 92%
Characteristics This is a rabbit polyclonal antibody against DLL1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name DLL1
Background DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication.DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication.
Molecular Weight 78kDa
Gene ID 28514
NCBI Accession NP_005609, NM_005618
UniProt O00548
Research Area Embryogenesis, Embryonic stem cells, Hematopoietic Progenitors, Hematopoietic Stem Cells, Transcription Factors, Neurogenesis, Lineage Markers
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DLL1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Dezso, Halász, Bisgaard et al.: "Delta-like protein (DLK) is a novel immunohistochemical marker for human hepatoblastomas." in: Virchows Archiv : an international journal of pathology, Vol. 452, Issue 4, pp. 443-8, 2008 (PubMed).

Alternatives for antigen "delta-Like 1 (DLL1)", type "Antibodies"
Hosts (31), (11), (8), (6), (4), (4)
Reactivities (43), (35), (23), (15), (12), (2)
Applications (34), (33), (17), (10), (10), (5), (3), (2), (1), (1), (1), (1)
Conjugates (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (4), (3), (2), (2), (2), (2), (1)
Beacon