Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406596

Peptidase D (PEPD) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PROLIDASE, Pep4, Pep-4, cb1000, fj78g11, wu:fj78g11, prolidase, MGC89151, DDBDRAFT_0190220, DDBDRAFT_0266378, DDB_0190220, DDB_0266378
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406596
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PEPD antibody: synthetic peptide directed towards the middle region of human PEPD
Sequence LGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLR TARHLQPGMV
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Chicken : 92%, Rabbit : 92%, Bovine : 91%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against PEPD. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PEPD
Background Xaa-Pro dipeptidase is a cytosolic dipeptidase that hydrolyzes dipeptides with proline or hydroxyproline at the carboxy terminus (but not Pro-Pro). It is important in collagen metabolism because of the high levels of iminoacids.Xaa-Pro dipeptidase is a cytosolic dipeptidase that hydrolyzes dipeptides with proline or hydroxyproline at the carboxy terminus (but not Pro-Pro). It is important in collagen metabolism because of the high levels of iminoacids.
Molecular Weight 54kDa
Gene ID 5184
NCBI Accession NP_000276, NM_000285
UniProt P12955
Research Area Proteolysis / Ubiquitin, Metabolism, Amino Acids
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PEPD antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Surazynski, Donald, Cooper et al.: "Extracellular matrix and HIF-1 signaling: the role of prolidase." in: International journal of cancer. Journal international du cancer, Vol. 122, Issue 6, pp. 1435-40, 2008 (PubMed).

Alternatives for antigen "Peptidase D (PEPD)", type "Antibodies"
Hosts (10), (9)
Reactivities (17), (4), (2)
Applications (18), (9), (6), (4), (3), (3), (2), (1)
Epitopes (6), (2), (2), (1), (1)
Beacon