SMT3 Suppressor of Mif Two 3 Homolog 3 (S. Cerevisiae) (SUMO3) (Middle Region) antibody

Details for Product No. ABIN406672
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
SMT3A, SMT3H1, SUMO-3, Smt3B, 2810014B19Rik, AA409334, AW121497, AW536077, D10Ertd345e, Smt3h1, ATSUMO3, MCO15.12, MCO15_12, SMALL UBIQUITIN-LIKE MODIFIER 3, SUM3, SUMO 3, small ubiquitin-like modifie ... show more
SMT3A, SMT3H1, SUMO-3, Smt3B, 2810014B19Rik, AA409334, AW121497, AW536077, D10Ertd345e, Smt3h1, ATSUMO3, MCO15.12, MCO15_12, SMALL UBIQUITIN-LIKE MODIFIER 3, SUM3, SUMO 3, small ubiquitin-like modifier 3, smt3a, smt3h1, fa94a11, im:7141764, sumo2, sumo3, sumo3l, wu:fa94a11, wu:fb55d09, zgc:65847, zgc:85643, fc66f10, fl11h12, wu:fc66f10, wu:fl11h12, zgc:86902, SUMO3 show less
Epitope
Middle Region
(15), (6), (5), (3), (1), (1), (1), (1)
Reactivity
Human
(64), (25), (22), (12), (12), (12), (12)
Host
Rabbit
(48), (17)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(54), (41), (20), (10), (8), (2), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN406672
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human SUMO3
Sequence MRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGV PESSLAGHSF
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against SUMO3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SUMO3
Background SUMO proteins, such as SUMO3, and ubiquitin (see MIM 191339) posttranslationally modify numerous cellular proteins and affect their metabolism and function. However, unlike ubiquitination, which targets proteins for degradation, sumoylation participates in a number of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability.SUMO proteins, such as SUMO3, and ubiquitin (see MIM 191339) posttranslationally modify numerous cellular proteins and affect their metabolism and function. However, unlike ubiquitination, which targets proteins for degradation, sumoylation participates in a number of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability (Su and Li, 2002 [PubMed 12383504]).
Molecular Weight 12 kDa
Gene ID 6612
NCBI Accession NM_006936, NP_008867
UniProt P55854
Research Area Signaling, Proteases, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 103 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-SMT3 Suppressor of Mif Two 3 Homolog 3 (S. Cerevisiae) (SUMO3) (Middle Region) antibody WB Suggested Anti-SUMO3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate
Background publications Zhang, Goeres, Zhang et al.: "SUMO-2/3 modification and binding regulate the association of CENP-E with kinetochores and progression through mitosis." in: Molecular cell, Vol. 29, Issue 6, pp. 729-41, 2008 (PubMed).

Hosts (48), (17)
Reactivities (64), (25), (22), (12), (12), (12), (12)
Applications (54), (41), (20), (10), (8), (2), (2), (1), (1)
Conjugates (3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (15), (6), (5), (3), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top