Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406672

SMT3 Suppressor of Mif Two 3 Homolog 3 (S. Cerevisiae) (SUMO3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
SMT3A, SMT3H1, SUMO-3, Smt3B, 2810014B19Rik, AA409334, AW121497, AW536077, D10Ertd345e, Smt3h1, ATSUMO3, MCO15.12, MCO15_12, SMALL UBIQUITIN-LIKE MODIFIER 3, SUM3, SUMO 3, small ubiquitin-like modifie ... show more
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406672
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SUMO3 antibody: synthetic peptide directed towards the middle region of human SUMO3
Sequence MRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGV PESSLAGHSF
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against SUMO3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SUMO3
Background SUMO proteins, such as SUMO3, and ubiquitin (see MIM 191339) posttranslationally modify numerous cellular proteins and affect their metabolism and function. However, unlike ubiquitination, which targets proteins for degradation, sumoylation participates in a number of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability.SUMO proteins, such as SUMO3, and ubiquitin (see MIM 191339) posttranslationally modify numerous cellular proteins and affect their metabolism and function. However, unlike ubiquitination, which targets proteins for degradation, sumoylation participates in a number of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability (Su and Li, 2002 [PubMed 12383504]).
Molecular Weight 12kDa
Gene ID 6612
NCBI Accession NP_008867, NM_006936
UniProt P55854
Research Area Signaling, Proteases, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SUMO3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Zhang, Goeres, Zhang et al.: "SUMO-2/3 modification and binding regulate the association of CENP-E with kinetochores and progression through mitosis." in: Molecular cell, Vol. 29, Issue 6, pp. 729-41, 2008 (PubMed).

Alternatives for antigen "SMT3 Suppressor of Mif Two 3 Homolog 3 (S. Cerevisiae) (SUMO3)", type "Antibodies"
Hosts (44), (11)
Reactivities (52), (26), (21), (12), (12), (12), (12), (1), (1)
Applications (42), (32), (11), (10), (9), (2), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (6), (4), (2), (1), (1), (1), (1)
Beacon