Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406693

EPH Receptor A5 (EPHA5) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CEK7, EHK-1, EHK1, EK7, HEK7, TYRO4, AI854630, AW125296, Cek7, Ehk1, Els1, Hek7, Rek7, bsk, Els1., EPHA5
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Pig (Porcine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406693
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-EPHA5 antibody: synthetic peptide directed towards the middle region of human EPHA5
Sequence SDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEA AYTTRGGKIP
Predicted Reactivity Bovine : 100%, Chicken : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Guinea pig : 92%
Characteristics This is a rabbit polyclonal antibody against EPHA5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name EPHA5
Background EPHA5 belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Two transcript variants encoding different isoforms have been found for this gene.This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands.
Molecular Weight 114kDa
Gene ID 2044
NCBI Accession NP_004430, NM_004439
UniProt P54756
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-EPHA5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "EPH Receptor A5 (EPHA5)", type "Antibodies"
Hosts (48), (19), (2), (1)
Reactivities (67), (36), (27), (17), (17), (17)
Applications (53), (40), (15), (12), (10), (8), (1)
Conjugates (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (6), (4), (4), (2), (2), (2), (2), (2), (1), (1), (1)
Beacon