Did you know that you can buy products from over 140 different suppliers from us?

EPH Receptor A5 (EPHA5) (Middle Region) antibody

Details for Product No. ABIN406693
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CEK7, EHK-1, EHK1, EK7, HEK7, TYRO4, AI854630, AW125296, Cek7, Ehk1, Els1, Hek7, Rek7, bsk, Els1., EPHA5
Epitope
Middle Region
(12), (10), (9), (7), (4), (3), (2), (2), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Pig (Porcine), Dog (Canine), Human, Chicken
(94), (34), (28), (17), (17), (17)
Host
Rabbit
(63), (31), (1), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(6), (5), (5), (5), (4), (4), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(79), (64), (26), (14), (12), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN406693
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human EPHA5
Sequence SDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEA AYTTRGGKIP
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Guinea pig : 90 %
Characteristics This is a rabbit polyclonal antibody against EPHA5. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name EPHA5
Background EPHA5 belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Two transcript variants encoding different isoforms have been found for this gene.This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands.
Molecular Weight 114 kDa
Gene ID 2044
NCBI Accession NM_004439, NP_004430
UniProt P54756
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1037 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-EPH Receptor A5 (EPHA5) (Middle Region) antibody WB Suggested Anti-EPHA5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406693
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top