Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406708

Tu Translation Elongation Factor, Mitochondrial (TUFM) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms P43, EFTU, COXPD4, EF-TuMT, C76308, C76389, 2300002G02Rik, D250, fi06f04, wu:fi06f04, zgc:110766, TUFM
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406708
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TUFM antibody: synthetic peptide directed towards the middle region of human TUFM
Sequence PEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIG TGLVTNTLAM
Predicted Reactivity Dog : 100%, Rabbit : 92%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against TUFM. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TUFM
Background TUFM is a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy. This gene encodes a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy. A pseudogene has been identified on chromosome 17.
Molecular Weight 50kDa
Gene ID 7284
NCBI Accession NP_003312, NM_003321
UniProt P49411
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TUFM antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Valente, Tiranti, Marsano et al.: "Infantile encephalopathy and defective mitochondrial DNA translation in patients with mutations of mitochondrial elongation factors EFG1 and EFTu." in: American journal of human genetics, Vol. 80, Issue 1, pp. 44-58, 2006 (PubMed).

Alternatives for antigen "Tu Translation Elongation Factor, Mitochondrial (TUFM)", type "Antibodies"
Hosts (19), (6)
Reactivities (24), (5), (4)
Applications (19), (12), (6), (3), (3), (3), (2), (2)
Epitopes (4), (4), (3), (2), (2), (2), (1), (1), (1), (1)
Beacon