Did you know that you can buy products from over 140 different suppliers from us?

Tu Translation Elongation Factor, Mitochondrial (TUFM) (Middle Region) antibody

Details for Product No. ABIN406708
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms P43, EFTU, COXPD4, EF-TuMT, C76308, C76389, 2300002G02Rik, D250, fi06f04, wu:fi06f04, zgc:110766, TUFM
Epitope
Middle Region
(3), (2), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Human
(19), (4), (3)
Host
Rabbit
(16), (4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(13), (10), (4), (4), (3), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN406708
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TUFM
Sequence PEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIG TGLVTNTLAM
Predicted Reactivity Dog : 100 %, Rabbit : 90 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against TUFM. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TUFM
Background TUFM is a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy. This gene encodes a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy. A pseudogene has been identified on chromosome 17.
Molecular Weight 50 kDa
Gene ID 7284
NCBI Accession NM_003321, NP_003312
UniProt P49411
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 455 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Tu Translation Elongation Factor, Mitochondrial (TUFM) (Middle Region) antibody WB Suggested Anti-TUFM Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate
Background publications Valente, Tiranti, Marsano et al.: "Infantile encephalopathy and defective mitochondrial DNA translation in patients with mutations of mitochondrial elongation factors EFG1 and EFTu." in: American journal of human genetics, Vol. 80, Issue 1, pp. 44-58, 2006 (PubMed).

Hosts (16), (4)
Reactivities (19), (4), (3)
Applications (13), (10), (4), (4), (3), (1), (1), (1)
Epitopes (3), (2), (2), (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406708
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top