Ring Finger Protein 41 (RNF41) (Middle Region) antibody

Details for Product No. ABIN487133
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FLRF, NRDP1, 2210404G21Rik, 4930511A05Rik, 4933415P08Rik, D10Ertd722e, Nrdp1, wu:fi13f07, wu:fi25b06, zgc:55389, flrf
Epitope
Middle Region
(11), (7), (3), (2), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human
(34), (13), (12), (12), (12)
Host
Rabbit
(29), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(23), (11), (10), (5), (4), (3), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN487133
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human RNF41
Sequence QQTRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAIRSVN PNLQNLEETI
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 80 %, African clawed frog : 70 %
Characteristics This is a rabbit polyclonal antibody against RNF41. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RNF41
Background RNF41 contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. The specific function of this protein has not yet been determined. The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. The specific function of this protein has not yet been determined. Three alternatively spliced transcript variants encoding two distinct isoforms have been reported.
Molecular Weight 28 kDa
Gene ID 10193
NCBI Accession NM_194358, NP_919339
UniProt A6NFW0
Research Area Proteolysis / Ubiquitin
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 246 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Cao, Wu, Yen et al.: "Neuregulin-induced ErbB3 downregulation is mediated by a protein stability cascade involving the E3 ubiquitin ligase Nrdp1." in: Molecular and cellular biology, Vol. 27, Issue 6, pp. 2180-8, 2007 (PubMed).

Hosts (29), (5)
Reactivities (34), (13), (12), (12), (12)
Applications (23), (11), (10), (5), (4), (3), (2), (1)
Conjugates (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (11), (7), (3), (2), (2), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top