Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487133

Ring Finger Protein 41 (RNF41) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FLRF, NRDP1, 2210404G21Rik, 4930511A05Rik, 4933415P08Rik, D10Ertd722e, Nrdp1, wu:fi13f07, wu:fi25b06, zgc:55389, flrf
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487133
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RNF41 antibody: synthetic peptide directed towards the middle region of human RNF41
Sequence QQTRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAIRSVN PNLQNLEETI
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 85%, African clawed frog : 78%
Characteristics This is a rabbit polyclonal antibody against RNF41. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RNF41
Background RNF41 contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. The specific function of this protein has not yet been determined. The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. The specific function of this protein has not yet been determined. Three alternatively spliced transcript variants encoding two distinct isoforms have been reported.
Molecular Weight 28kDa
Gene ID 10193
NCBI Accession NP_919339, NM_194358
UniProt A6NFW0
Research Area Proteolysis / Ubiquitin
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RNF41 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Cao, Wu, Yen et al.: "Neuregulin-induced ErbB3 downregulation is mediated by a protein stability cascade involving the E3 ubiquitin ligase Nrdp1." in: Molecular and cellular biology, Vol. 27, Issue 6, pp. 2180-8, 2007 (PubMed).

Alternatives for antigen "Ring Finger Protein 41 (RNF41)", type "Antibodies"
Hosts (22), (5)
Reactivities (27), (13), (13), (12), (12)
Applications (17), (10), (7), (4), (4), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (2), (2), (2), (1), (1), (1)
Beacon