AMHR2 antibody (C-Term)
-
- Target See all AMHR2 Antibodies
- AMHR2 (Anti-Mullerian Hormone Receptor, Type II (AMHR2))
-
Binding Specificity
- AA 384-419, C-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This AMHR2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Anti-Muellerian hormone type-2 receptor(AMHR2) detection. Tested with WB in Human,Rat.
- Sequence
- QRYMAPELLD KTLDLQDWGM ALRRADIYSL ALLLWE
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Anti-Muellerian hormone type-2 receptor(AMHR2) detection. Tested with WB in Human,Rat.
Gene Name: anti-Mullerian hormone receptor type 2
Protein Name: Anti-Muellerian hormone type-2 receptor - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human AMHR2 (384-419aa QRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWE), different from the related mouse and rat sequences by three amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product AMHR2 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- AMHR2 (Anti-Mullerian Hormone Receptor, Type II (AMHR2))
- Alternative Name
- AMHR2 (AMHR2 Products)
- Synonyms
- AMHR antibody, MISR2 antibody, MISRII antibody, MRII antibody, Misiir antibody, Misrii antibody, Mrii antibody, anti-Mullerian hormone receptor type 2 antibody, anti-Mullerian hormone type 2 receptor antibody, AMHR2 antibody, Amhr2 antibody
- Target Type
- Antibody
- Background
-
AMHR2 is the receptor for the anti-Mullerian hormone (AMH) which, in addition to testosterone, results in male sex differentiation. AMH and testosterone are produced in the testes by different cells and have different effects. Testosterone promotes the development of male genitalia while the binding of AMH to the encoded receptor prevents the development of the mullerian ducts into uterus and Fallopian tubes. Mutations in this gene are associated with persistent Mullerian duct syndrome type II. Alternatively spliced transcript variants encoding different isoforms have been identified.
Synonyms: AMH | AMH type II receptor | AMHR | AMHR2 | MIS type II receptor | MISR2 | MISRII | MRII | Q16671 - Gene ID
- 269
- UniProt
- Q16671
-