ACCN1 antibody (N-Term)

Catalog No. ABIN4886476

Product Details anti-ACCN1 Antibody

Target: ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))

Binding Specificity: AA 112-147, N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACCN1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Acid-sensing ion channel 2(ASIC2) detection. Tested with WB in Human,Rat.

Sequence: ELLALLDVNL QIPDPHLADP SVLEALRQKA NFKHYK

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Acid-sensing ion channel 2(ASIC2) detection. Tested with WB in Human,Rat.
Gene Name: acid sensing ion channel subunit 2
Protein Name: Acid-sensing ion channel 2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ACCN1 (112-147aa ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for ACCN1

Target: ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))

Alternative Name: ASIC2 (ACCN1 Products)

Synonyms: ACCN antibody, ACCN1 antibody, ASIC2a antibody, BNC1 antibody, BNaC1 antibody, MDEG antibody, hBNaC1 antibody, ACIC2 antibody, Accn1 antibody, BNaC1a antibody, Mdeg antibody, BNC1k antibody, MDEG1 antibody, MDEG2 antibody, accn1 antibody, zASIC2 antibody, acid sensing ion channel subunit 2 antibody, acid-sensing (proton-gated) ion channel 2 antibody, ASIC2 antibody, Asic2 antibody, asic2 antibody

Background: Amiloride-sensitive cation channel 1, neuronal, also known as ASIC2, is a protein that in humans is encoded by the ACCN1 gene. This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene may play a role in neurotransmission. In addition, a heteromeric association between this member and acid-sensing (proton-gated) ion channel 3 has been observed to co-assemble into proton-gated channels sensitive to gadolinium. Alternative splicing has been observed at this locus and two variants, encoding distinct isoforms, have been identified.

Synonyms: Acid sensing ion channel 2 | ACCN | ACCN1 | ASIC2 | ASIC2a | BNaC1 | BNC1 | Brain sodium channel 1 | Degenerin | MDEG | Q16515

Gene ID: 40

UniProt: Q16515

Pathways: Sensory Perception of Sound