PSMA1 antibody (C-Term)
-
- Target See all PSMA1 Antibodies
- PSMA1 (Proteasome Subunit alpha Type 1 (PSMA1))
-
Binding Specificity
- AA 159-204, C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PSMA1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-1(PSMA1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- MSIGARSQSA RTYLERHMSE FMECNLNELV KHGLRALRET LP
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-1(PSMA1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: proteasome subunit alpha 1
Protein Name: Proteasome subunit alpha type-1 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human PSMA1 (159-204aa MSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLP AEQD), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product PSMA1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- PSMA1 (Proteasome Subunit alpha Type 1 (PSMA1))
- Alternative Name
- PSMA1 (PSMA1 Products)
- Synonyms
- PSMA1 antibody, pros30 antibody, DDBDRAFT_0204226 antibody, DDBDRAFT_0214956 antibody, DDB_0204226 antibody, DDB_0214956 antibody, C2 antibody, HC2 antibody, Pros-30 antibody, alpha-type antibody, NU antibody, PROS30 antibody, CC2 antibody, zgc:92726 antibody, 143314_at antibody, Alpha-6 antibody, CG4904 antibody, Dmel\CG4904 antibody, PROS-35 antibody, PROS-Dm35 antibody, Pros-35 antibody, Pros-Dm35 antibody, Prosalpha6 antibody, alpha6 antibody, alpha_dm antibody, anon-SAGE:Wang-116 antibody, pros 35 antibody, pros35 antibody, proteasome subunit alpha 1 antibody, proteasome subunit alpha type 1 antibody, 20S proteasome subunit C2 antibody, proteasome (prosome, macropain) subunit, alpha type 1 antibody, proteasome subunit alpha 1 L homeolog antibody, Proteasome alpha6 subunit antibody, PSMA1 antibody, psma1 antibody, CNB05540 antibody, psmA1 antibody, Psma1 antibody, psma1.L antibody, Prosalpha6 antibody
- Background
-
Proteasome subunit alpha type-1 is a protein that in humans is encoded by the PSMA1 gene. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Synonyms: HC 2 | HC2 | PROS30 | PROS-30 | PROS 30 | PSC 2 | PSC2 | PSMA 1 | PSMA1 | P25786 - Gene ID
- 5682
- UniProt
- P25786
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-