SYN1 antibody (C-Term)
-
- Target See all SYN1 Antibodies
- SYN1 (Synapsin I (SYN1))
-
Binding Specificity
- AA 662-705, C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SYN1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Synapsin-1(SYN1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- KSQSLTNAFN LPEPAPPRPS LSQDEVKAET IRSLRKSFAS L
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Synapsin-1(SYN1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: synapsin I
Protein Name: Synapsin-1 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human Synapsin I (662-705aa KSQSLTNAFNLPEPAPPRPSLSQDEVKAETIRSLRKSFASL FSD), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product SYN1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
- Target
- SYN1 (Synapsin I (SYN1))
- Alternative Name
- SYN1 (SYN1 Products)
- Synonyms
- SYN1a antibody, SYN1b antibody, SYNI antibody, Syn-1 antibody, SYN I antibody, si:dkey-90n12.3 antibody, synapsin I antibody, synapsin I L homeolog antibody, SYN1 antibody, Syn1 antibody, syn1.L antibody, syn1 antibody
- Background
-
Synapsin I, is the collective name for Synapsin Ia and Synapsin Ib, two nearly identical phosphoproteins that in humans are encoded by the SYN1 gene. This gene is a member of the synapsin gene family. Synapsins encode neuronal phosphoproteins which associate with the cytoplasmic surface of synaptic vesicles. Family members are characterized by common protein domains, and they are implicated in synaptogenesis and the modulation of neurotransmitter release, suggesting a potential role in several neuropsychiatric diseases. This member of the synapsin family plays a role in regulation of axonogenesis and synaptogenesis. The protein encoded serves as a substrate for several different protein kinases and phosphorylation may function in the regulation of this protein in the nerve terminal. Mutations in this gene may be associated with X-linked disorders with primary neuronal degeneration such as Rett syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified.
Synonyms: SYN 1 | SYN 1a | SYN1a | SYN 1b | SYN1b | SYN I | SYNI | Synapsin1 | Synapsin-1 | Synapsin 1 | SYNI | P17600 - Gene ID
- 6853
- UniProt
- P17600
-