Histone Deacetylase 8 (HDAC8) (N-Term) antibody

Details for Product No. ABIN501306
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms CDLS5, HD8, HDACL1, MRXS6, RPD3, WTS, 2610007D20Rik, RGD1562895, zgc:66196, wu:fd19a02, ATHDA8, HDA8, HISTONE DEACETYLASE 8, T27G7.14, T27G7_14, histone deacetylase 8
Epitope
N-Term
(31), (4), (4), (3), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(91), (61), (57), (26), (24), (24), (12), (12), (1), (1)
Host
Rabbit
(86), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(63), (31), (26), (20), (18), (13), (8), (3), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN501306
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human HDAC8
Sequence MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASM VHSLIEAYAL
Predicted Reactivity Human : 100 %, Horse : 90 %, Guinea pig : 90 %, Bovine : 80 %, Dog : 80 %, Mouse : 70 %, Rabbit : 70 %, Rat : 70 %
Characteristics This is a rabbit polyclonal antibody against HDAC8. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name HDAC8
Background Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class I of the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class I of the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter.
Molecular Weight 42 kDa
Gene ID 55869
NCBI Accession NM_018486, NP_060956
UniProt Q9BY41
Research Area Cardiovascular, Hypertrophy, Wnt, Transcription Factors, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 377 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Balasubramanian, Ramos, Luo et al.: "A novel histone deacetylase 8 (HDAC8)-specific inhibitor PCI-34051 induces apoptosis in T-cell lymphomas." in: Leukemia, Vol. 22, Issue 5, pp. 1026-34, 2008 (PubMed).

Hosts (86), (7)
Reactivities (91), (61), (57), (26), (24), (24), (12), (12), (1), (1)
Applications (63), (31), (26), (20), (18), (13), (8), (3), (1), (1), (1)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (31), (4), (4), (3), (1), (1), (1), (1), (1)
back to top