Did you know that you can buy products from over 140 different suppliers from us?

Neuronal Calcium Sensor 1 (NCS1) (Middle Region) antibody

Details for Product No. ABIN501328
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FREQ, NCS-1, FLUP, Freq, Mfreq, AI836659, 9430075O15Rik, A730032G13Rik, flup, freq, xfreq, LOC100189965, MGC75953
Epitope
Middle Region
(11), (9), (8), (5), (3), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish (Danio rerio), Cow (Bovine), Fruit Fly (Drosophila melanogaster), Human, Chicken
(58), (32), (21), (13), (2), (1), (1), (1)
Host
Rabbit
(54), (10), (4), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(59), (40), (19), (16), (14), (10), (9), (5), (2), (1), (1), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN501328
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human FREQ
Sequence EEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSI VQALSLYDGL
Predicted Reactivity Chicken : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against FREQ. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FREQ
Background This gene is a member of the neuronal calcium sensor gene family, which encode calcium-binding proteins expressed predominantly in neurons. The protein encoded by this gene regulates G protein-coupled receptor phosphorylation in a calcium-dependent manner
Molecular Weight 22 kDa
Gene ID 23413
NCBI Accession NM_014286, NP_055101
UniProt P62166
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 190 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Neuronal Calcium Sensor 1 (NCS1) (Middle Region) antibody Immunohistochemistry with Small intestine, myetneric plexus tissue at an antibody concentration of 5-10µg/ml using anti-FREQ antibody (ARP34711_P050)
Product cited in: Szafranski, Schindler, Taudien et al.: "Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns." in: Genome biology, Vol. 8, Issue 8, pp. R154, 2008 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501328
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top