Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501328

Neuronal Calcium Sensor 1 (NCS1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FREQ, NCS-1, FLUP, Freq, Mfreq, AI836659, 9430075O15Rik, A730032G13Rik, flup, freq, xfreq, LOC100189965, MGC75953
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish (Danio rerio), Cow (Bovine), Fruit Fly (Drosophila melanogaster), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501328
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FREQ antibody: synthetic peptide directed towards the middle region of human FREQ
Sequence EEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSI VQALSLYDGL
Predicted Reactivity Chicken : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against FREQ. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FREQ
Background This gene is a member of the neuronal calcium sensor gene family, which encode calcium-binding proteins expressed predominantly in neurons. The protein encoded by this gene regulates G protein-coupled receptor phosphorylation in a calcium-dependent manner
Molecular Weight 22kDa
Gene ID 23413
NCBI Accession NP_055101, NM_014286
UniProt P62166
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FREQ antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Szafranski, Schindler, Taudien et al.: "Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns." in: Genome biology, Vol. 8, Issue 8, pp. R154, 2008 (PubMed).

Alternatives for antigen "Neuronal Calcium Sensor 1 (NCS1)", type "Antibodies"
Hosts (40), (11), (5), (3)
Reactivities (45), (34), (21), (13), (3), (1), (1), (1)
Applications (47), (29), (15), (14), (10), (8), (6), (3), (2), (1), (1), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (4), (3), (3), (2), (2), (2), (1), (1)
Beacon