Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501497

Zinc Finger Protein 669 (ZNF669) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501497
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF669 antibody: synthetic peptide directed towards the N terminal of human ZNF669
Sequence LDSSQKNLYREVMQETCRNLASVGSQWKDQNIEDHFEKPG KDIRNHIVQR
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against ZNF669. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF669
Background ZNF669 may be involved in transcriptional regulation.
Molecular Weight 52kDa
Gene ID 79862
NCBI Accession NP_079080, NM_024804
UniProt Q96BR6
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF669 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Alternatives for antigen "Zinc Finger Protein 669 (ZNF669)", type "Antibodies"
Hosts (7)
Reactivities (7), (1), (1), (1)
Applications (7), (1), (1)
Epitopes (4), (2), (1)
Beacon