Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 669 (ZNF669) (N-Term) antibody

Details for Product No. ABIN501497
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
(4), (2), (1)
Reactivity
Human
(7), (1), (1), (1)
Host
Rabbit
(7)
Clonality
Polyclonal
Application
Western Blotting (WB)
(7)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN501497
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF669
Sequence LDSSQKNLYREVMQETCRNLASVGSQWKDQNIEDHFEKPG KDIRNHIVQR
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF669. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF669
Background ZNF669 may be involved in transcriptional regulation.
Molecular Weight 52 kDa
Gene ID 79862
NCBI Accession NM_024804, NP_079080
UniProt Q96BR6
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 464 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 669 (ZNF669) (N-Term) antibody WB Suggested Anti-ZNF669 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: THP-1 cell lysate
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501497
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top