DEAH (Asp-Glu-Ala-His) Box Polypeptide 34 (DHX34) (Middle Region) antibody

Details for Product No. ABIN501548
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Ddx34, mKIAA0134, 1200013B07Rik, 1810012L18Rik, DDX34, HRH1
Epitope
Middle Region
(1), (1)
Reactivity
Mouse (Murine), Dog (Canine), Cow (Bovine), Human
(2), (1), (1), (1)
Host
Rabbit
(4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(4)
Pubmed 1 reference available
Catalog no. ABIN501548
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human DHX34
Sequence APQDGPPGAEEAALETLQKTSVLQRPYHCEACGKDFLFTP TEVLRHRKQH
Predicted Reactivity Horse : 100 %, Human : 100 %, Dog : 90 %, Mouse : 90 %, Rabbit : 90 %, Bovine : 80 %, Guinea pig : 80 %, Pig : 80 %
Characteristics This is a rabbit polyclonal antibody against DHX34. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name DHX34
Background DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and m
Molecular Weight 128 kDa
Gene ID 9704
NCBI Accession NM_014681, NP_055496
UniProt Q14147
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1143 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-DEAH (Asp-Glu-Ala-His) Box Polypeptide 34 (DHX34) (Middle Region) antibody WB Suggested Anti-DHX34 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: THP-1 cell lysate
Background publications Smith, Tachibana, Pohl et al.: "A transcript map of the chromosome 19q-arm glioma tumor suppressor region." in: Genomics, Vol. 64, Issue 1, pp. 44-50, 2000 (PubMed).

Hosts (4)
Reactivities (2), (1), (1), (1)
Applications (4)
Epitopes (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top