Signal Transducer and Activator of Transcription 5A (STAT5A) antibody

Antigen: Signal Transducer and Activator of Transcription 5A (STAT5A)

Synonyms: MGF, STAT5, AA959963, Stat5, STATA5, STAT5A/MGF, STAT5A

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine)

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN501656

Additional Information

Alternative name: STAT5 / STAT5A

Gene ID: STAT5A

UniProt: P42229

Immunogen: The immunogen for anti-STAT5A antibody: synthetic peptide directed towards the C terminal of human STAT5A

Sequence: DQAPSPAVCPQAPYNMYPQNPDHVLDQDGEFDLDETMDVA RHVEELLRRP

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-STAT5A antibody concentration is 1 mg/ml.

Description: STAT5A is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated by, and mediates the responses of many cell ligands, such as IL2, IL3, IL7 GM-CSF, erythropoietin, thrombopoietin, and different growth hormones. Activation of this protein in myeloma and lymphoma associated with a TEL/JAK2 gene fusion is independent of cell stimulus and has been shown to be essential for the tumorigenesis. The mouse counterpart of this gene is found to induce the expression of BCL2L1/BCL-X(L), which suggests the antiapoptotic function of this gene in cells. The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated by, and mediates the responses of many cell ligands, such as IL2, IL3, IL7 GM-CSF, erythropoietin, thrombopoietin, and different growth hormones. Activation of this protein in myeloma and lymphoma associated with a TEL/JAK2 gene fusion is independent of cell stimulus and has been shown to be essential for the tumorigenesis. The mouse counterpart of this gene is found to induce the expression of BCL2L1/BCL-X(L), which suggests the antiapoptotic function of this gene in cells. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 794 amino acids

Molecular Weight: 91kDa

Application Details

Application Notes: WB Suggested Anti-STAT5A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Muscle.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-STAT5A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Muscle

Publications

Product: Subtil-Rodríguez, Millán-Ariño, Quiles et al.: "Progesterone induction of the 11beta-hydroxysteroid dehydrogenase type 2 promoter in breast cancer cells involves coordinated recruitment of STAT5A and progesterone receptor to a distal enhancer and polymerase tracking." in: Molecular and cellular biology, Vol. 28, Issue 11, pp. 3830-49, 2008 (PubMed).

Murayama, Ohmori, Fujimura et al.: "Epigenetic control of rDNA loci in response to intracellular energy status." in: Cell, Vol. 133, Issue 4, pp. 627-39, 2008 (PubMed).