Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501747

Nuclear Factor of Activated T-Cells 5, Tonicity-Responsive (NFAT5) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NF-AT5, NFATL1, NFATZ, OREBP, TONEBP, Nfat, TonEBP, CAG-8, CAG80, nfatz, AI225870, mKIAA0827, B130038B15Rik, zgc:63502, wu:fi46f11, NFAT5, orebp, nf-at5, nfatl1, tonebp, DKFZp469P1514
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501747
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NFAT5 antibody: synthetic peptide directed towards the middle region of human NFAT5
Sequence PGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKID LLVSLQNQGN
Predicted Reactivity Guinea pig : 100%, Human : 100%, Bovine : 92%, Rabbit : 92%, Dog : 85%, Horse : 85%, Pig : 85%
Characteristics This is a rabbit polyclonal antibody against NFAT5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NFAT5
Background NFAT5 is a member of the nuclear factors of activated T cells family of transcription factors. Proteins belonging to this family play a central role in inducible gene transcription during the immune response. This protein regulates gene expression induced by osmotic stress in mammalian cells. Unlike monomeric members of this protein family, this protein exists as a homodimer and forms stable dimers with DNA elements.The product of this gene is a member of the nuclear factors of activated T cells family of transcription factors. Proteins belonging to this family play a central role in inducible gene transcription during the immune response. This protein regulates gene expression induced by osmotic stress in mammalian cells. Unlike monomeric members of this protein family, this protein exists as a homodimer and forms stable dimers with DNA elements. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Weight 166kDa
Gene ID 10725
NCBI Accession NP_006590, NM_006599
UniProt O94916
Research Area Chromatin and Nuclear Signaling, Transcription Factors, Adaptive Immunity
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NFAT5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Zhou, Ferraris, Dmitrieva et al.: "MKP-1 inhibits high NaCl-induced activation of p38 but does not inhibit the activation of TonEBP/OREBP: opposite roles of p38alpha and p38delta." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 105, Issue 14, pp. 5620-5, 2008 (PubMed).

Alternatives for antigen "Nuclear Factor of Activated T-Cells 5, Tonicity-Responsive (NFAT5)", type "Antibodies"
Hosts (48), (4)
Reactivities (50), (41), (25), (24), (24), (12)
Applications (24), (24), (20), (8), (5), (4), (4), (2), (2), (1)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (16), (5), (3), (2), (2), (1), (1), (1)
Beacon