Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502048

Polypyrimidine Tract Binding Protein 2 (PTBP2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PTB, PTBLP, brPTB, nPTB, nPTB5, nPTB6, nPTB7, nPTB8, Ptb2, im:7153495, ptbp2, si:ch211-160l17.2, wu:fa08f05, wu:fc05d10, PTBP2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502048
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PTBP2 antibody: synthetic peptide directed towards the N terminal of human PTBP2
Sequence AITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRA QAVLQAVTAV
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Rabbit : 100%, Mouse : 92%, Rat : 92%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against PTBP2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PTBP2
Background The protein encoded by this gene binds to the intronic cluster of RNA regulatory elements, downstream control sequence (DCS). It is implicated in controlling the assembly of other splicing-regulatory proteins. This protein is very similar to the polypyrim
Molecular Weight 57kDa
Gene ID 58155
NCBI Accession NP_067013, NM_021190
UniProt Q9UKA9
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PTBP2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Galbán, Kuwano, Pullmann et al.: "RNA-binding proteins HuR and PTB promote the translation of hypoxia-inducible factor 1alpha." in: Molecular and cellular biology, Vol. 28, Issue 1, pp. 93-107, 2007 (PubMed).

Alternatives for antigen "Polypyrimidine Tract Binding Protein 2 (PTBP2)", type "Antibodies"
Hosts (20), (6), (5)
Reactivities (28), (18), (18), (13), (13), (1)
Applications (20), (17), (10), (5), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (1), (1)
Beacon