Polypyrimidine Tract Binding Protein 2 (PTBP2) (N-Term) antibody

Details for Product No. ABIN502048
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms PTB, PTBLP, brPTB, nPTB, nPTB5, nPTB6, nPTB7, nPTB8, Ptb2, im:7153495, ptbp2, si:ch211-160l17.2, wu:fa08f05, wu:fc05d10, PTBP2
Epitope
N-Term
(3), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human
(29), (18), (18), (13), (13), (1)
Host
Rabbit
(21), (6), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(20), (14), (10), (5), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN502048
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PTBP2
Sequence AITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRA QAVLQAVTAV
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Rabbit : 100 %, Mouse : 90 %, Rat : 90 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against PTBP2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PTBP2
Background The protein encoded by this gene binds to the intronic cluster of RNA regulatory elements, downstream control sequence (DCS). It is implicated in controlling the assembly of other splicing-regulatory proteins. This protein is very similar to the polypyrim
Molecular Weight 57 kDa
Gene ID 58155
NCBI Accession NM_021190, NP_067013
UniProt Q9UKA9
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 531 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Polypyrimidine Tract Binding Protein 2 (PTBP2) (N-Term) antibody WB Suggested Anti-PTBP2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: PANC1 cell lysate
Background publications Galbán, Kuwano, Pullmann et al.: "RNA-binding proteins HuR and PTB promote the translation of hypoxia-inducible factor 1alpha." in: Molecular and cellular biology, Vol. 28, Issue 1, pp. 93-107, 2007 (PubMed).

Hosts (21), (6), (4)
Reactivities (29), (18), (18), (13), (13), (1)
Applications (20), (14), (10), (5), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (1), (1)
back to top