Surfactant Protein C (SFTPC) (N-Term) antibody

Details for Product No. ABIN502129
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BRICD6, PSP-C, SFTP2, SMDP2, SP-C, SFTPC, SPC, psp-c, sftp2, xSP-C
Epitope
N-Term
(13), (10), (8), (7), (4), (2), (2), (1)
Reactivity
Human
(42), (24), (14), (12)
Host
Rabbit
(43), (8)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB), Immunohistochemistry (IHC)
(41), (25), (13), (12), (10), (7), (7), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN502129
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SFTPC
Sequence MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVV VVVVLIVVVI
Predicted Reactivity Human : 100 %, Guinea pig : 80 %, Pig : 80 %, Sheep : 80 %, Mouse : 70 %
Characteristics This is a rabbit polyclonal antibody against SFTPC. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SFTPC
Background This gene encodes the pulmonary-associated surfactant protein C (SPC), an extremely hydrophobic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90 % lipids
Molecular Weight 21 kDa
Gene ID 6440
NCBI Accession NM_003018, NP_003009
UniProt P11686
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 197 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Surfactant Protein C (SFTPC) (N-Term) antibody WB Suggested Anti-SFTPC Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: COLO205 cell lysate
anti-Surfactant Protein C (SFTPC) (N-Term) antibody (2) anti-Surfactant Protein C (SFTPC) (N-Term) antibody (Image 2)
anti-Surfactant Protein C (SFTPC) (N-Term) antibody (3) anti-Surfactant Protein C (SFTPC) (N-Term) antibody (Image 3)
Background publications Garmany, Wambach, Heins et al.: "Population and disease-based prevalence of the common mutations associated with surfactant deficiency." in: Pediatric research, Vol. 63, Issue 6, pp. 645-9, 2008 (PubMed).

Hosts (43), (8)
Reactivities (42), (24), (14), (12)
Applications (41), (25), (13), (12), (10), (7), (7), (3), (1)
Conjugates (3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (13), (10), (8), (7), (4), (2), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top