Did you know that you can buy products from over 140 different suppliers from us?

Matrilin 1, Cartilage Matrix Protein (MATN1) (Middle Region) antibody

Details for Product No. ABIN502205
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CMP, CRTM, Crtm, Mat1, matrilin-1, cmp, crtm, xmatn1, MGC64509, MGC108367
Epitope
Middle Region
(18), (9), (8), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(50), (30), (30), (12)
Host
Rabbit
(44), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(42), (35), (16), (12), (10), (4), (4), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN502205
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human MATN1
Sequence KYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKK AKDLGFKMFA
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against MATN1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MATN1
Background This gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins are thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. Mutations of this gene ha
Molecular Weight 54 kDa
Gene ID 4146
NCBI Accession NM_002379, NP_002370
UniProt P21941
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 496 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Matrilin 1, Cartilage Matrix Protein (MATN1) (Middle Region) antibody WB Suggested Anti-MATN1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: OVCAR-3 cell lysate
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502205
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top