Mitogen-Activated Protein Kinase Kinase 3 (MAP2K3) antibody

Antigen: Mitogen-Activated Protein Kinase Kinase 3 (MAP2K3)

Synonyms: MEK3, MKK3, MAPKK3, PRKMK3, Prkmk3, mMKK3b, AW212142

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish, Xenopus laevis, Chicken

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN502212

Additional Information

Alternative name: MAP2K3

Gene ID: MAP2K3

UniProt: P46734-2

Immunogen: The immunogen for anti-MAP2K3 antibody: synthetic peptide directed towards the C terminal of human MAP2K3

Sequence: EEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEH PFFTLHKTKK

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-MAP2K3 antibody concentration is 1 mg/ml.

Description: MAP2K3 is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK. This kinase can be activated by insulin, and is necessary for the expression of glucose transporter. Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, which thus leads to the constitutive activation of MAPK14, and confers oncogenic transformation of primary cells. The inhibition of this kinase is involved in the pathogenesis of Yersina pseudotuberculosis. The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK. This kinase can be activated by insulin, and is necessary for the expression of glucose transporter. Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, which thus leads to the constitutive activation of MAPK14, and confers oncogenic transformation of primary cells. The inhibition of this kinase is involved in the pathogenesis of Yersina pseudotuberculosis. Multiple alternatively spliced transcript variants that encode distinct isoforms have been reported for this gene.

Characteristics: Antigen Size: 318 amino acids

Molecular Weight: 36kDa

Application Details

Application Notes: WB Suggested Anti-MAP2K3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Kinases/Phosphatases

Restrictions: For Research Use only

Images

WB Suggested Anti-MAP2K3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate

Publications

Product: Prickett, Brautigan: "Cytokine activation of p38 mitogen-activated protein kinase and apoptosis is opposed by alpha-4 targeting of protein phosphatase 2A for site-specific dephosphorylation of MEK3." in: Molecular and cellular biology, Vol. 27, Issue 12, pp. 4217-27, 2007 (PubMed).