Did you know that you can buy products from over 140 different suppliers from us?

Procollagen-Lysine 2-Oxoglutarate 5-Dioxygenase 2 (PLOD2) (Middle Region) antibody

Details for Product No. ABIN502295
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms D530025C14Rik, LH2, Plod-2, TLH
Epitope
Middle Region
(3), (3), (2), (1), (1), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Cow (Bovine), Pig (Porcine), Human
(19), (8), (3)
Host
Rabbit
(19), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(20), (6), (3), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502295
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PLOD2
Sequence IKGKTLRSEMNERNYFVRDKLDPDMALCRNAREMTLQREK DSPTPETFQM
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Chicken : 70 %
Characteristics This is a rabbit polyclonal antibody against PLOD2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PLOD2
Background PLOD2 forms hydroxylysine residues in -Xaa-Lys-Gly- sequences in collagens. These hydroxylysines serve as sites of attachment for carbohydrate units and are essential for the stability of the intermolecular collagen cross-links.The protein encoded by this gene is a membrane-bound homodimeric enzyme that is localized to the cisternae of the rough endoplasmic reticulum. The enzyme (cofactors iron and ascorbate) catalyzes the hydroxylation of lysyl residues in collagen-like peptides. The resultant hydroxylysyl groups are attachment sites for carbohydrates in collagen and thus are critical for the stability of intermolecular crosslinks. Some patients with Ehlers-Danlos syndrome type VIB have deficiencies in lysyl hydroxylase activity. Mutations in the coding region of this gene are associated with Bruck syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms.
Molecular Weight 84 kDa
Gene ID 5352
NCBI Accession NM_182943, NP_891988
UniProt O00469-2
Research Area Cancer, Extracellular Matrix
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 758 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Procollagen-Lysine 2-Oxoglutarate 5-Dioxygenase 2 (PLOD2) (Middle Region) antibody WB Suggested Anti-PLOD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: DU145 cell lysate
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Validation Images
back to top