Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502652

Nuclear Receptor Subfamily 2, Group C, Member 2 (NR2C2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TR4, TAK1, TR2R1, hTAK1, Tr4, im:6911408, gb:dq017625, mKIAA4145, Tak1, B430101B05, C87327
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502652
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NR2C2 antibody: synthetic peptide directed towards the N terminal of human NR2C2
Sequence INKHHRNRCQFCRLKKCLEMGMKMESVQSERKPFDVQREK PSNCAASTEK
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Chicken : 92%
Characteristics This is a rabbit polyclonal antibody against NR2C2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NR2C2
Background Members of the nuclear hormone receptor family, such as NR2C2, act as ligand-activated transcription factors. The proteins have an N-terminal transactivation domain, a central DNA-binding domain with 2 zinc fingers, and a ligand-binding domain at the C terminus. The activated receptor/ligand complex is translocated to the nucleus where it binds to hormone response elements of target genes. Members of the nuclear hormone receptor family, such as NR2C2, act as ligand-activated transcription factors. The proteins have an N-terminal transactivation domain, a central DNA-binding domain with 2 zinc fingers, and a ligand-binding domain at the C terminus. The activated receptor/ligand complex is translocated to the nucleus where it binds to hormone response elements of target genes (Yoshikawa et al., 1996 [PubMed 8661150]).
Molecular Weight 67kDa
Gene ID 7182
NCBI Accession NP_003289, NM_003298
UniProt P49116
Research Area Chromatin and Nuclear Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NR2C2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Bouwmeester, Bauch, Ruffner et al.: "A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway." in: Nature cell biology, Vol. 6, Issue 2, pp. 97-105, 2004 (PubMed).

Alternatives for antigen "Nuclear Receptor Subfamily 2, Group C, Member 2 (NR2C2)", type "Antibodies"
Hosts (123), (8)
Reactivities (122), (103), (102), (74), (61), (48), (14), (2), (2), (1), (1)
Applications (77), (60), (52), (27), (6), (2), (2), (1), (1)
Conjugates (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6)
Epitopes (34), (24), (12), (12), (12), (10), (7), (2), (2), (2), (2), (2), (1)
Beacon