PGD Synthetase (PGDS) antibody

Antigen: PGD Synthetase (PGDS)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN502983

Additional Information

Alternative name: PGD synthetase / PGDS

Gene ID: PGDS

UniProt: O60760

Immunogen: The immunogen for anti-PGDS antibody: synthetic peptide directed towards the N terminal of human PGDS

Sequence: EQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKN TDLAGNTEME

Cross-Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-PGDS antibody concentration is 1 mg/ml.

Description: PGDS is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes. Prostaglandin-D synthase is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 199 amino acids

Molecular Weight: 23kDa

Application Details

Application Notes: WB Suggested Anti-PGDS Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Spleen.
Immunohistochemistry with Lung tissue at an antibody concentration of 5µg/ml using anti-PGDS antibody (ABIN502983).

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-PGDS Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Spleen

Immunohistochemistry with Lung tissue at an antibody concentration of 5µg/ml using anti-PGDS antibody (ARP48763_P050)

Publications

Product: Inoue, Okano, Kado et al.: "First determination of the inhibitor complex structure of human hematopoietic prostaglandin D synthase." in: Journal of biochemistry, Vol. 135, Issue 3, pp. 279-83, 2004 (PubMed).