Tyrosine-Protein Kinase JAK3 (JAK3) antibody

Antigen: Tyrosine-Protein Kinase JAK3 (JAK3)

Synonyms: JAKL, LJAK, JAK-3, L-JAK, JAK3_HUMAN

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Chicken

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN503512

Additional Information

Alternative name: Tyrosine-protein kinase JAK3

Gene ID: JAK3

UniProt: P52333

Immunogen: The immunogen for anti-JAK3 antibody: synthetic peptide directed towards the middle region of human JAK3

Sequence: KLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVW SFGVVLYELF

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-JAK3 antibody concentration is 1 mg/ml.

Description: JAK3 is a member of the Janus kinase (JAK) family of tyrosine kinases, which is involved in cytokine receptor-mediated intracellular signal transduction. JAK3 is predominantly expressed in immune cells and transduces a signal in response to its activation via tyrosine phosphorylation by interleukin receptors. Mutations in JAK3 are associated with autosomal SCID (severe combined immunodeficiency disease).The protein encoded by this gene is a member of the Janus kinase (JAK) family of tyrosine kinases involved in cytokine receptor-mediated intracellular signal transduction. It is predominantly expressed in immune cells and transduces a signal in response to its activation via tyrosine phosphorylation by interleukin receptors. Mutations in this gene are associated with autosomal SCID (severe combined immunodeficiency disease). Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 1124 amino acids

Molecular Weight: 125kDa

Application Details

Application Notes: WB Suggested Anti-JAK3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Small Intestine.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling, Cytokines, Receptors, Kinases/Phosphatases

Restrictions: For Research Use only

Images

WB Suggested Anti-JAK3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Small Intestine

Publications

Product: Cheng, Ross, Frost et al.: "Phosphorylation of human Jak3 at tyrosines 904 and 939 positively regulates its activity." in: Molecular and cellular biology, Vol. 28, Issue 7, pp. 2271-82, 2008 (PubMed).