Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503701

EH-Domain Containing 4 (EHD4) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PAST4, Past2, AI197390, AI846352, AV006278, 2210022F10Rik, EHD4, past4
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503701
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-EHD4 antibody: synthetic peptide directed towards the middle region of human EHD4
Sequence KAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNL ISQEETSTPT
Predicted Reactivity Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Bovine : 92%, Guinea pig : 92%, Rabbit : 92%, Chicken : 85%, African clawed frog : 76%
Characteristics This is a rabbit polyclonal antibody against EHD4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name EHD4
Background EHD4 is involved in the control of trafficking at the early endosome and regulates exit of cargo toward both the recycling compartment and the late endocytic pathway.
Molecular Weight 61kDa
Gene ID 30844
NCBI Accession NP_644670, NM_139265
UniProt Q9H223
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-EHD4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "EH-Domain Containing 4 (EHD4)", type "Antibodies"
Hosts (11), (4)
Reactivities (13), (3), (3), (1), (1)
Applications (15), (7), (2), (1), (1), (1)
Epitopes (2), (2), (1), (1)
Beacon