EH-Domain Containing 4 (EHD4) (Middle Region) antibody

Details for Product No. ABIN503701
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PAST4, Past2, AI197390, AI846352, AV006278, 2210022F10Rik, EHD4, past4
Epitope
Middle Region
(2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human
(12), (3), (3), (1), (1)
Host
Rabbit
(10), (4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(14), (6), (2), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN503701
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human EHD4
Sequence KAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNL ISQEETSTPT
Predicted Reactivity Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Bovine : 90 %, Guinea pig : 90 %, Rabbit : 90 %, Chicken : 80 %, African clawed frog : 70 %
Characteristics This is a rabbit polyclonal antibody against EHD4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name EHD4
Background EHD4 is involved in the control of trafficking at the early endosome and regulates exit of cargo toward both the recycling compartment and the late endocytic pathway.
Molecular Weight 61 kDa
Gene ID 30844
NCBI Accession NM_139265, NP_644670
UniProt Q9H223
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 541 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-EH-Domain Containing 4 (EHD4) (Middle Region) antibody WB Suggested Anti-EHD4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Lung
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Hosts (10), (4)
Reactivities (12), (3), (3), (1), (1)
Applications (14), (6), (2), (1), (1), (1)
Epitopes (2), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top