UBA Domain Containing 2 (UBAC2) (Middle Region) antibody

Details for Product No. ABIN503746
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms 1190008A14Rik, AW554959, Phgdhl1, PHGDHL1, UBAC2, phgdhl1, MGC185596
Epitope
Middle Region
(1), (1)
Reactivity
Mouse (Murine), Cow (Bovine), Human
(2)
Host
Rabbit
(3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(3), (1)
Pubmed 1 reference available
Catalog no. ABIN503746
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human UBAC2
Sequence YCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIWI VAISGLMSGL
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Bovine : 90 %
Characteristics This is a rabbit polyclonal antibody against UBAC2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name UBAC2
Background The specific functin of this protein remains unknown.
Molecular Weight 35 kDa
Gene ID 337867
NCBI Accession NM_177967, NP_808882
UniProt Q8NBM4-2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 309 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-UBA Domain Containing 2 (UBAC2) (Middle Region) antibody WB Suggested Anti-UBAC2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: 721_B cell lysate
Background publications Dunham, Matthews, Burton et al.: "The DNA sequence and analysis of human chromosome 13." in: Nature, Vol. 428, Issue 6982, pp. 522-8, 2004 (PubMed).

Hosts (3)
Reactivities (2)
Applications (3), (1)
Epitopes (1), (1)
back to top