Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503746

UBA Domain Containing 2 (UBAC2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1190008A14Rik, AW554959, Phgdhl1, PHGDHL1, UBAC2, phgdhl1, MGC185596
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503746
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-UBAC2 antibody: synthetic peptide directed towards the middle region of human UBAC2
Sequence YCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIWI VAISGLMSGL
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Bovine : 92%
Characteristics This is a rabbit polyclonal antibody against UBAC2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name UBAC2
Background The specific functin of this protein remains unknown.
Molecular Weight 35kDa
Gene ID 337867
NCBI Accession NP_808882, NM_177967
UniProt Q8NBM4-2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-UBAC2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Dunham, Matthews, Burton et al.: "The DNA sequence and analysis of human chromosome 13." in: Nature, Vol. 428, Issue 6982, pp. 522-8, 2004 (PubMed).

Alternatives for antigen "UBA Domain Containing 2 (UBAC2)", type "Antibodies"
Hosts (5)
Reactivities (4), (3)
Applications (5), (3)
Epitopes (3), (2), (1), (1)
Beacon