Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503865

Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 2 (RPS6KA2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RSK, HU-2, RSK3, p90-RSK3, pp90RSK3, MAPKAPK1C, S6K-alpha, S6K-alpha2
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503865
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RPS6KA2 antibody: synthetic peptide directed towards the middle region of human RPS6KA2
Sequence LSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQR RGMKRLTSTR
Predicted Reactivity Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Bovine : 92%, Rabbit : 85%
Characteristics This is a rabbit polyclonal antibody against RPS6KA2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RPS6KA2
Background RPS6KA2 is a serine/threonine kinase that may play a role in mediating the growth-factor and stress induced activation of the transcription factor CREB.This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Molecular Weight 81kDa
Gene ID 6196
NCBI Accession NP_066958, NM_021135
UniProt Q15349
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RPS6KA2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Wissing, Jänsch, Nimtz et al.: "Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry." in: Molecular & cellular proteomics : MCP, Vol. 6, Issue 3, pp. 537-47, 2007 (PubMed).

Alternatives for antigen "Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 2 (RPS6KA2)", type "Antibodies"
Hosts (64), (7)
Reactivities (67), (53), (39), (24), (24), (12)
Applications (38), (30), (28), (14), (5), (4), (2), (1), (1), (1), (1)
Conjugates (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3)
Epitopes (28), (16), (12), (9), (3), (2), (2), (1), (1), (1), (1), (1)
Beacon