Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503968

Mitogen-Activated Protein Kinase 1/3 (MAPK1/3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SAPK4, Serk4, Prkm13, MAPK 13, MAPK-13, PRKM13, p38delta, erk1/2, sapk4, prkm13
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503968
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MAPK13 antibody: synthetic peptide directed towards the middle region of human MAPK13
Sequence KMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDD SLEHEKLTVD
Predicted Reactivity Guinea pig : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Bovine : 92%, Dog : 92%, Pig : 92%, Rabbit : 92%, Sheep : 92%, Goat : 85%
Characteristics This is a rabbit polyclonal antibody against MAPK13. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MAPK13
Background The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription
Molecular Weight 42kDa
Gene ID 5603
NCBI Accession NP_002745, NM_002754
UniProt O15264
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MAPK13 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Zhou, Ferraris, Dmitrieva et al.: "MKP-1 inhibits high NaCl-induced activation of p38 but does not inhibit the activation of TonEBP/OREBP: opposite roles of p38alpha and p38delta." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 105, Issue 14, pp. 5620-5, 2008 (PubMed).

Alternatives for antigen "Mitogen-Activated Protein Kinase 1/3 (MAPK1/3)", type "Antibodies"
Hosts (37), (33)
Reactivities (70), (15), (13), (11), (11)
Applications (59), (32), (27), (23), (9), (5), (4), (2), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (10), (5), (5), (3), (2), (2), (2), (1), (1), (1)
Beacon