Did you know that you can buy products from over 140 different suppliers from us?

Mitogen-Activated Protein Kinase 1/3 (MAPK1/3) (Middle Region) antibody

Details for Product No. ABIN503968
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SAPK4, Serk4, Prkm13, MAPK 13, MAPK-13, PRKM13, p38delta, erk1/2, sapk4, prkm13
Epitope
Middle Region
(12), (8), (7), (7), (5), (3), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(86), (16), (15), (11), (11)
Host
Rabbit
(46), (41)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(75), (42), (27), (19), (10), (10), (9), (2), (2), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503968
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human MAPK13
Sequence KMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDD SLEHEKLTVD
Predicted Reactivity Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Bovine : 90 %, Dog : 90 %, Pig : 90 %, Rabbit : 90 %, Sheep : 90 %, Goat : 80 %
Characteristics This is a rabbit polyclonal antibody against MAPK13. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MAPK13
Background The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription
Molecular Weight 42 kDa
Gene ID 5603
NCBI Accession NM_002754, NP_002745
UniProt O15264
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 365 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Mitogen-Activated Protein Kinase 1/3 (MAPK1/3) (Middle Region) antibody WB Suggested Anti-MAPK13 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: NCI-H226 cell lysate
Background publications Zhou, Ferraris, Dmitrieva et al.: "MKP-1 inhibits high NaCl-induced activation of p38 but does not inhibit the activation of TonEBP/OREBP: opposite roles of p38alpha and p38delta." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 105, Issue 14, pp. 5620-5, 2008 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503968
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top