MAPK13 antibody (C-Term)

Catalog No. ABIN3043610

Product Details anti-MAPK13 Antibody

Target: MAPK13 (Mitogen-Activated Protein Kinase 13 (MAPK13))

Binding Specificity: AA 332-365, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAPK13 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Mitogen-activated protein kinase 13(MAPK13) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: KLTVDEWKQH IYKEIVNFSP IARKDSRRRS GMKL

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Mitogen-activated protein kinase 13(MAPK13) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: mitogen-activated protein kinase 13
Protein Name: Mitogen-activated protein kinase 13

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SAPK4 (332-365aa KLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for MAPK13

Target: MAPK13 (Mitogen-Activated Protein Kinase 13 (MAPK13))

Alternative Name: MAPK13 (MAPK13 Products)

Synonyms: F24B9.3 antibody, F24B9_3 antibody, MAPK 13 antibody, MAPK-13 antibody, PRKM13 antibody, SAPK4 antibody, p38delta antibody, Serk4 antibody, Prkm13 antibody, sapk4 antibody, prkm13 antibody, Protein kinase superfamily protein antibody, mitogen-activated protein kinase 13 antibody, mitogen activated protein kinase 13 antibody, ATMPK13 antibody, MAPK13 antibody, Mapk13 antibody, mapk13 antibody

Background: MAPK13 (Mitogen-Activated Protein Kinase 13), also called p38-DELTA or Stress-Activated Protein Kinase 4(SAPK4), is an enzyme that in humans is encoded by the MAPK13 gene. The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and cellular stress. MAP kinase kinases 3, and 6 can phosphorylate and activate this kinase. Transcription factor ATF2, and microtubule dynamics regulator stathmin have been shown to be the substrates of this kinase.

Synonyms: MAP kinase 13 antibody|MAP kinase p38 delta antibody|MAPK 13 antibody|MAPK-13 antibody| Mapk13 antibody|MGC99536 antibody|Mitogen activated protein kinase 13 antibody|Mitogen-activated protein kinase 13 antibody|Mitogen-activated protein kinase p38 delta antibody| MK13_HUMAN antibody|OTTHUMP00000016282 antibody|OTTHUMP00000016283 antibody|p38 delta antibody|P38delta antibody|PRKM13 antibody|SAPK 4 antibody|SAPK4 antibody|Stress activated protein kinase 4 antibody|Stress-activated protein kinase 4 antibody

Gene ID: 5603

UniProt: O15264

Pathways: MAPK Signaling, Neurotrophin Signaling Pathway, Hepatitis C, BCR Signaling, S100 Proteins