Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503979

Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 1 (PSMD1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms P112, Rpn2, S1, 2410026J11Rik, zgc:55818, 11888, CG11888, Dmel\\CG11888, PSMC1, RPN2, dRpn2, p110
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503979
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PSMD1 antibody: synthetic peptide directed towards the N terminal of human PSMD1
Sequence HYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQRCLDDHK YKQAIGIALE
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, African clawed frog : 85%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against PSMD1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PSMD1
Background The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits a
Molecular Weight 106kDa
Gene ID 5707
NCBI Accession NP_002798, NM_002807
UniProt Q99460
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PSMD1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 1 (PSMD1)", type "Antibodies"
Hosts (12), (1), (1)
Reactivities (11), (3), (1), (1), (1), (1)
Applications (12), (2), (2), (2), (1)
Epitopes (6), (2), (2), (1), (1)
Beacon