Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503982

Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 10 (PSMD10) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AW554874, p28Gank, dJ889N15.2, p28, p28(GANK), gankyrin, zgc:109707
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503982
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PSMD10 antibody: synthetic peptide directed towards the middle region of human PSMD10
Sequence MHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDE ERVEEAKLLV
Predicted Reactivity Dog : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, African clawed frog : 91%, Zebrafish : 91%, Chicken : 83%
Characteristics This is a rabbit polyclonal antibody against PSMD10. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PSMD10
Background The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits a
Molecular Weight 24kDa
Gene ID 5716
NCBI Accession NP_002805, NM_002814
UniProt O75832
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PSMD10 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Umemura, Itoh, Itoh et al.: "Association of gankyrin protein expression with early clinical stages and insulin-like growth factor-binding protein 5 expression in human hepatocellular carcinoma." in: Hepatology (Baltimore, Md.), Vol. 47, Issue 2, pp. 493-502, 2008 (PubMed).

Alternatives for antigen "Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 10 (PSMD10)", type "Antibodies"
Hosts (42), (8)
Reactivities (47), (19), (17), (15), (12), (3), (2), (1)
Applications (39), (11), (10), (7), (6), (3), (3), (1), (1)
Conjugates (3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (4), (3), (2), (2), (2), (1), (1)
Beacon