Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 10 (PSMD10) (Middle Region) antibody

Details for Product No. ABIN503982
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms gankyrin, zgc:109707, dJ889N15.2, p28, p28(GANK), AW554874, p28Gank
Epitope
Middle Region
(7), (5), (5), (4), (3), (2), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(48), (17), (15), (12), (12)
Host
Rabbit
(43), (8)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(42), (11), (10), (6), (5), (4), (3), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503982
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PSMD10
Sequence MHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDE ERVEEAKLLV
Predicted Reactivity Dog : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, African clawed frog : 90 %, Zebrafish : 90 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against PSMD10. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PSMD10
Background The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits a
Molecular Weight 24 kDa
Gene ID 5716
NCBI Accession NP_002805, NM_002814
UniProt O75832
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 226 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 10 (PSMD10) (Middle Region) antibody WB Suggested Anti-PSMD10 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: ACHN cell lysate
Background publications Umemura, Itoh, Itoh et al.: "Association of gankyrin protein expression with early clinical stages and insulin-like growth factor-binding protein 5 expression in human hepatocellular carcinoma." in: Hepatology (Baltimore, Md.), Vol. 47, Issue 2, pp. 493-502, 2008 (PubMed).

Validation Images
Did you look for something else?
back to top