Protein Kinase, AMP-Activated, beta 2 Non-Catalytic Subunit (PRKAB2) (Middle Region) antibody

Details for Product No. ABIN504035
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms AW049591, BB124140, 5730553K21Rik, prkab2, MGC64365, PRKAB2, DKFZp469M1118
Epitope
Middle Region
(9), (4), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(37), (17), (15), (12), (12), (12)
Host
Rabbit
(29), (6), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(25), (10), (9), (8), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN504035
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PRKAB2
Sequence RDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILN KDTNISCDPA
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against PRKAB2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PRKAB2
Background The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme tha
Molecular Weight 30 kDa
Gene ID 5565
NCBI Accession NM_005399, NP_005390
UniProt O43741
Research Area Cancer, Metabolism, Fatty Acids
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 272 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Protein Kinase, AMP-Activated, beta 2 Non-Catalytic Subunit (PRKAB2) (Middle Region) antibody WB Suggested Anti-PRKAB2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Hosts (29), (6), (3)
Reactivities (37), (17), (15), (12), (12), (12)
Applications (25), (10), (9), (8), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (4), (2), (1), (1)
back to top