Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504035

Protein Kinase, AMP-Activated, beta 2 Non-Catalytic Subunit (PRKAB2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AW049591, BB124140, 5730553K21Rik, prkab2, MGC64365, PRKAB2, DKFZp469M1118
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504035
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PRKAB2 antibody: synthetic peptide directed towards the middle region of human PRKAB2
Sequence RDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILN KDTNISCDPA
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against PRKAB2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PRKAB2
Background The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme tha
Molecular Weight 30kDa
Gene ID 5565
NCBI Accession NP_005390, NM_005399
UniProt O43741
Research Area Cancer, Metabolism, Fatty Acids
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PRKAB2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Protein Kinase, AMP-Activated, beta 2 Non-Catalytic Subunit (PRKAB2)", type "Antibodies"
Hosts (26), (6), (3)
Reactivities (34), (16), (14), (12), (12), (12)
Applications (22), (10), (10), (8), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (5), (1), (1), (1)
Beacon