Did you know that you can buy products from over 140 different suppliers from us?

Protein Phosphatase 2, Regulatory Subunit B', gamma (PPP2CA) (Middle Region) antibody

Details for Product No. ABIN504357
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms B56G, PR61G, C85228, AI060890, AW545884, mKIAA0044, D12Bwg0916e, 2610043M05Rik, 2700063L20Rik, b56g, ppp2r5c, si:dkey-241l7.9
Epitope
Middle Region
(8), (7), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(38), (14), (14), (13), (12)
Host
Rabbit
(29), (9), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(29), (11), (10), (8), (3), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN504357
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PPP2R5C
Sequence RFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFL KTTLHRIYGK
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against PPP2R5C. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PPP2R5C
Background The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common het
Molecular Weight 45 kDa
Gene ID 5527
NCBI Accession NM_178588, NP_848703
UniProt Q96B13
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 384 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Protein Phosphatase 2, Regulatory Subunit B', gamma (PPP2CA) (Middle Region) antibody WB Suggested Anti-PPP2R5C Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
Background publications Shouse, Cai, Liu: "Serine 15 phosphorylation of p53 directs its interaction with B56gamma and the tumor suppressor activity of B56gamma-specific protein phosphatase 2A." in: Molecular and cellular biology, Vol. 28, Issue 1, pp. 448-56, 2007 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN504357
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top