Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504357

Protein Phosphatase 2, Regulatory Subunit B', gamma (PPP2CA) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms B56G, PR61G, C85228, AI060890, AW545884, mKIAA0044, D12Bwg0916e, 2610043M05Rik, 2700063L20Rik, b56g, ppp2r5c, si:dkey-241l7.9
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504357
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PPP2R5C antibody: synthetic peptide directed towards the middle region of human PPP2R5C
Sequence RFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFL KTTLHRIYGK
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against PPP2R5C. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PPP2R5C
Background The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common het
Molecular Weight 45kDa
Gene ID 5527
NCBI Accession NP_848703, NM_178588
UniProt Q96B13
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PPP2R5°Cantibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Shouse, Cai, Liu: "Serine 15 phosphorylation of p53 directs its interaction with B56gamma and the tumor suppressor activity of B56gamma-specific protein phosphatase 2A." in: Molecular and cellular biology, Vol. 28, Issue 1, pp. 448-56, 2007 (PubMed).

Alternatives for antigen "Protein Phosphatase 2, Regulatory Subunit B', gamma (PPP2CA)", type "Antibodies"
Hosts (21), (11), (1)
Reactivities (32), (15), (14), (14), (12)
Applications (24), (10), (8), (5), (3), (1)
Conjugates (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (1), (1), (1), (1)
Beacon