Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504586

Cyclin-Dependent Kinase 3 (CDK3) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2310050O10Rik, Cdk3, AI852479, B230379H01Rik
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504586
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CDK3 antibody: synthetic peptide directed towards the C terminal of human CDK3
Sequence NLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSP AARQYVLQRF
Predicted Reactivity Human : 100%, Mouse : 93%, Rabbit : 87%, Dog : 86%, Bovine : 81%
Characteristics This is a rabbit polyclonal antibody against CDK3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CDK3
Background CDK3 is a member of the cyclin-dependent protein kinase family. The protein promotes entry into S phase, in part by activating members of the E2F family of transcription factors. The protein also associates with cyclin C and phosphorylates the retinoblastoma 1 protein to promote exit from G0.This gene encodes a member of the cyclin-dependent protein kinase family. The protein promotes entry into S phase, in part by activating members of the E2F family of transcription factors. The protein also associates with cyclin C and phosphorylates the retinoblastoma 1 protein to promote exit from G0.
Molecular Weight 35kDa
Gene ID 1018
NCBI Accession NP_001249, NM_001258
UniProt Q00526
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CDK3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Wissing, Jänsch, Nimtz et al.: "Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry." in: Molecular & cellular proteomics : MCP, Vol. 6, Issue 3, pp. 537-47, 2007 (PubMed).

Alternatives for antigen "Cyclin-Dependent Kinase 3 (CDK3)", type "Antibodies"
Hosts (28), (3)
Reactivities (31), (14), (12), (12), (12), (12), (12), (12)
Applications (22), (10), (10), (6), (3), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (2), (2), (2), (1), (1), (1), (1)
Beacon