ESRP1 antibody (N-Term)
-
- Target See all ESRP1 Antibodies
- ESRP1 (Epithelial Splicing Regulatory Protein 1 (ESRP1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ESRP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RBM35 A antibody was raised against the N terminal of RBM35
- Purification
- Purified
- Immunogen
- RBM35 A antibody was raised using the N terminal of RBM35 corresponding to a region with amino acids MTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKF
- Top Product
- Discover our top product ESRP1 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RBM35A Blocking Peptide, catalog no. 33R-6542, is also available for use as a blocking control in assays to test for specificity of this RBM35A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM30 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ESRP1 (Epithelial Splicing Regulatory Protein 1 (ESRP1))
- Alternative Name
- RBM35A (ESRP1 Products)
- Synonyms
- rbm35a antibody, RBM35A antibody, RMB35A antibody, 2210008M09Rik antibody, A630065D16 antibody, BC031468 antibody, Rbm35a antibody, RGD1560481 antibody, wu:fi28a07 antibody, zgc:154050 antibody, epithelial splicing regulatory protein 1 antibody, epithelial splicing regulatory protein 1 L homeolog antibody, ESRP1 antibody, esrp1.L antibody, Esrp1 antibody, esrp1 antibody
- Background
- RBM35A functions as a tumor suppressor in colon cancer cells.
- Molecular Weight
- 68 kDa (MW of target protein)
-