XRCC6 antibody (N-Term)

Catalog No. ABIN629624

The Rabbit Polyclonal anti-XRCC6 antibody is suitable to detect XRCC6 in samples from Human. It has been validated for WB and IHC.

Quick Overview for XRCC6 antibody (N-Term) (ABIN629624)

Target: XRCC6 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 6 (XRCC6))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This XRCC6 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-XRCC6 Antibody

Binding Specificity: N-Term

Specificity: G22 P1 antibody was raised against the N terminal Of G22 1

Purification: Purified

Immunogen: G22 P1 antibody was raised using the N terminal Of G22 1 corresponding to a region with amino acids NFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVL

Application Details

Application Notes: WB: 0.6 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

G22P1 Blocking Peptide, (ABIN5613682), is also available for use as a blocking control in assays to test for specificity of this G22P1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of G20 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for XRCC6

Target: XRCC6 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 6 (XRCC6))

Alternative Name: G22P1

Background: The p70/p80 autoantigen is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus.

Molecular Weight: 70 kDa (MW of target protein)

Pathways: DNA Damage Repair