DDX31 antibody
-
- Target See all DDX31 Antibodies
- DDX31 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 31 (DDX31))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DDX31 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- DDX31 antibody was raised using a synthetic peptide corresponding to a region with amino acids QASSEAPPAKRRNETSFLPAKKTSVKETQRTFKGNAQKMFSPKKHSVSTS
- Top Product
- Discover our top product DDX31 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DDX31 Blocking Peptide, catalog no. 33R-7480, is also available for use as a blocking control in assays to test for specificity of this DDX31 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX31 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DDX31 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 31 (DDX31))
- Alternative Name
- DDX31 (DDX31 Products)
- Synonyms
- fc62b08 antibody, si:ch211-89p1.3 antibody, wu:fc62b08 antibody, DDX31 antibody, PPP1R25 antibody, 5830444G11Rik antibody, Gm997 antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 31 antibody, DEAD-box helicase 31 antibody, DEAD-box helicase 31 L homeolog antibody, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 31 antibody, ddx31 antibody, DDX31 antibody, ddx31.L antibody, Ddx31 antibody
- Background
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX31 is a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates 2 transcript variants.
- Molecular Weight
- 64 kDa (MW of target protein)
-