P2RX1 antibody (Middle Region)
-
- Target See all P2RX1 Antibodies
- P2RX1 (Purinergic Receptor P2X, Ligand Gated Ion Channel 1 (P2RX1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This P2RX1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- P2 RX1 antibody was raised against the middle region of P2 X1
- Purification
- Purified
- Immunogen
- P2 RX1 antibody was raised using the middle region of P2 X1 corresponding to a region with amino acids VVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVENG
- Top Product
- Discover our top product P2RX1 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
P2RX1 Blocking Peptide, catalog no. 33R-9880, is also available for use as a blocking control in assays to test for specificity of this P2RX1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 X1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- P2RX1 (Purinergic Receptor P2X, Ligand Gated Ion Channel 1 (P2RX1))
- Alternative Name
- P2RX1 (P2RX1 Products)
- Synonyms
- p2xr1 antibody, P2X1 antibody, AI323649 antibody, BB122383 antibody, P2x antibody, Pdcd3 antibody, RP-2 antibody, P2XMR antibody, P2X1R antibody, purinergic receptor P2X, ligand-gated ion channel, 1 antibody, purinergic receptor P2X 1 antibody, calcium/calmodulin dependent protein kinase kinase 1 antibody, p2rx1 antibody, P2RX1 antibody, P2rx1 antibody, CAMKK1 antibody
- Background
- P2RX1 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel with relatively high calcium permeability. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle, being responsible, for example, for sympathetic vasoconstriction in small arteries, arterioles and vas deferens. Mouse studies suggest that this receptor is essential for normal male reproductive function. It is possible that the development of selective antagonists for this receptor may provide an effective non-hormonal male contraceptive pill.
- Molecular Weight
- 45 kDa (MW of target protein)
- Pathways
- Positive Regulation of Endopeptidase Activity
-