FGA antibody (N-Term)

Catalog No. ABIN630126

Product Details anti-FGA Antibody

Target: FGA (Fibrinogen alpha Chain (FGA))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FGA antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: Fibrinogen Alpha antibody was raised against the N terminal of FGA

Purification: Purified

Immunogen: Fibrinogen Alpha antibody was raised using the N terminal of FGA corresponding to a region with amino acids MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDS

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Fibrinogen Alpha Blocking Peptide, catalog no. 33R-6003, is also available for use as a blocking control in assays to test for specificity of this Fibrinogen Alpha antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

References for anti-FGA antibody (ABIN630126)

Matsumoto, Matsuura, Aoki, Maehashi, Iwamoto, Ohkawa, Yoshida, Yanaga, Takada: "An efficient system for secretory production of fibrinogen using a hepatocellular carcinoma cell line." in: Hepatology research : the official journal of the Japan Society of Hepatology, Vol. 45, Issue 3, pp. 315-25, (2016) (PubMed).

Target Details for FGA

Target: FGA (Fibrinogen alpha Chain (FGA))

Alternative Name: Fibrinogen alpha (FGA Products)

Synonyms: Fib2 antibody, ENSMUSG00000059807 antibody, Fib antibody, Ac1873 antibody, Fba5e antibody, fibrinogen alpha chain antibody, FGA antibody, Fga antibody, LOC698244 antibody

Background: FGA is the alpha component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in its gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia, afibrinogenemia and renal amyloidosis.

Molecular Weight: 71 kDa (MW of target protein)