MMP1 antibody
-
- Target See all MMP1 Antibodies
- MMP1 (Matrix Metallopeptidase 1 (Interstitial Collagenase) (MMP1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MMP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- MMP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKA
- Top Product
- Discover our top product MMP1 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MMP1 Blocking Peptide, catalog no. 33R-10200, is also available for use as a blocking control in assays to test for specificity of this MMP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MMP1 (Matrix Metallopeptidase 1 (Interstitial Collagenase) (MMP1))
- Alternative Name
- MMP1 (MMP1 Products)
- Synonyms
- CLG antibody, CLGN antibody, Mmp1a antibody, CG4859 antibody, Dm1-MMP antibody, Dmel\\CG4859 antibody, MMP-1 antibody, MMP1 antibody, Mmp 1 antibody, dMMP1 antibody, dm1-MMP antibody, dmmp1 antibody, l(2)k04809 antibody, mmp1 antibody, Mmp1 antibody, Mcol-A antibody, Mcola antibody, col4 antibody, mmp18 antibody, Clgn antibody, matrix metallopeptidase 1 antibody, Matrix metalloproteinase 1 antibody, matrix metalloproteinase 1 antibody, matrix metallopeptidase 1 (interstitial collagenase) antibody, matrix metallopeptidase 1a (interstitial collagenase) antibody, matrix metallopeptidase 1 S homeolog antibody, interstitial collagenase antibody, matrix metallopeptidase 8 L homeolog antibody, MMP1 antibody, Mmp1 antibody, RB11133 antibody, Mmp1a antibody, mmp1.S antibody, LOC100727966 antibody, mmp8.L antibody
- Background
- Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP1 is a secreted enzyme which breaks down the interstitial collagens, types I, II, and III.
- Molecular Weight
- 52 kDa (MW of target protein)
-